SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260868752|ref|YP_003235154.1| from Escherichia coli O111:H- str. 11128

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260868752|ref|YP_003235154.1|
Domain Number 1 Region: 18-243
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.81e-45
Family Spore coat polysaccharide biosynthesis protein SpsA 0.0033
Further Details:      
 
Weak hits

Sequence:  gi|260868752|ref|YP_003235154.1|
Domain Number - Region: 242-288
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0553
Family Group I mobile intron endonuclease 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260868752|ref|YP_003235154.1|
Sequence length 297
Comment putative glycosyl transferase [Escherichia coli O111:H- str. 11128]
Sequence
MDLQKLDKYTCNGNLDAPLVSIIIATYNSELDIAKCLQSVTNQSYKNIEIIIMDGGSSDK
TLDIAKSFKDDRIKIVSEKDRGIYDAWNKAVDLSIGDWVAFIGSDDVYYHTDAIASLMKG
VMVSNGAPVVYGRTAHEGPDRNISGFSGSEWYNLTGFKFNYYKCNLPLPIMSAIYSRDFF
RNERFDIKLKIVADADWFLRCFIKWSKEKSPYFINDTTPIVRMGYGGVSTDISSQVKTTL
ESFIVRKKNNISCLNIQLILRYAKILVMVAIKNIFGNNVYKLMHNGYHSLKKIKNKI
Download sequence
Identical sequences A0A027TVU9 C8UCY1 H4UL01 I2UNG2 K4VKR1 Q9S520 V8FCT8
gi|260868752|ref|YP_003235154.1| WP_000365650.1.100571 WP_000365650.1.101630 WP_000365650.1.101786 WP_000365650.1.101952 WP_000365650.1.102122 WP_000365650.1.10651 WP_000365650.1.11616 WP_000365650.1.12743 WP_000365650.1.1295 WP_000365650.1.13301 WP_000365650.1.14693 WP_000365650.1.15335 WP_000365650.1.15593 WP_000365650.1.1582 WP_000365650.1.17623 WP_000365650.1.18438 WP_000365650.1.19332 WP_000365650.1.19494 WP_000365650.1.20334 WP_000365650.1.21137 WP_000365650.1.23078 WP_000365650.1.23593 WP_000365650.1.24024 WP_000365650.1.25378 WP_000365650.1.27424 WP_000365650.1.29055 WP_000365650.1.29082 WP_000365650.1.29669 WP_000365650.1.31319 WP_000365650.1.31340 WP_000365650.1.31518 WP_000365650.1.31866 WP_000365650.1.32287 WP_000365650.1.33680 WP_000365650.1.35316 WP_000365650.1.35927 WP_000365650.1.37510 WP_000365650.1.37995 WP_000365650.1.38103 WP_000365650.1.38626 WP_000365650.1.39123 WP_000365650.1.40403 WP_000365650.1.41125 WP_000365650.1.41613 WP_000365650.1.42516 WP_000365650.1.42748 WP_000365650.1.42832 WP_000365650.1.43270 WP_000365650.1.4415 WP_000365650.1.45595 WP_000365650.1.46070 WP_000365650.1.46105 WP_000365650.1.46477 WP_000365650.1.46555 WP_000365650.1.46614 WP_000365650.1.46743 WP_000365650.1.47034 WP_000365650.1.48077 WP_000365650.1.48096 WP_000365650.1.48615 WP_000365650.1.48801 WP_000365650.1.48954 WP_000365650.1.49107 WP_000365650.1.49229 WP_000365650.1.49856 WP_000365650.1.50258 WP_000365650.1.51278 WP_000365650.1.52171 WP_000365650.1.54307 WP_000365650.1.54708 WP_000365650.1.54798 WP_000365650.1.55144 WP_000365650.1.5520 WP_000365650.1.55988 WP_000365650.1.56721 WP_000365650.1.58172 WP_000365650.1.58983 WP_000365650.1.60606 WP_000365650.1.61948 WP_000365650.1.64014 WP_000365650.1.64150 WP_000365650.1.68175 WP_000365650.1.682 WP_000365650.1.68215 WP_000365650.1.68609 WP_000365650.1.70582 WP_000365650.1.71113 WP_000365650.1.73075 WP_000365650.1.73663 WP_000365650.1.73835 WP_000365650.1.75676 WP_000365650.1.77477 WP_000365650.1.77608 WP_000365650.1.78775 WP_000365650.1.80141 WP_000365650.1.810 WP_000365650.1.81376 WP_000365650.1.81517 WP_000365650.1.82378 WP_000365650.1.82572 WP_000365650.1.8308 WP_000365650.1.84140 WP_000365650.1.84881 WP_000365650.1.86263 WP_000365650.1.86451 WP_000365650.1.86997 WP_000365650.1.87639 WP_000365650.1.88535 WP_000365650.1.88880 WP_000365650.1.89067 WP_000365650.1.90834 WP_000365650.1.91551 WP_000365650.1.91565 WP_000365650.1.91971 WP_000365650.1.93338 WP_000365650.1.94507 WP_000365650.1.96247 WP_000365650.1.97434 WP_000365650.1.9816 WP_000365650.1.98357 WP_000365650.1.98549 585396.ECO111_2757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]