SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260869832|ref|YP_003236234.1| from Escherichia coli O111:H- str. 11128

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260869832|ref|YP_003236234.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.38e-110
Family FMN-linked oxidoreductases 0.00000000000998
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.06e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000032
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.8e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260869832|ref|YP_003236234.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase [Escherichia coli O111:H- str. 11128]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFTWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYHRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIARFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAIELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A027U0E5 C8UG39 I2UD01 K4VIY0 V8FIM0
585396.ECO111_3903 gi|260869832|ref|YP_003236234.1| WP_000121460.1.101630 WP_000121460.1.101786 WP_000121460.1.101952 WP_000121460.1.102122 WP_000121460.1.11616 WP_000121460.1.12743 WP_000121460.1.1295 WP_000121460.1.15335 WP_000121460.1.15593 WP_000121460.1.1582 WP_000121460.1.17623 WP_000121460.1.18436 WP_000121460.1.19332 WP_000121460.1.19494 WP_000121460.1.21137 WP_000121460.1.23078 WP_000121460.1.24024 WP_000121460.1.25378 WP_000121460.1.27424 WP_000121460.1.29082 WP_000121460.1.29669 WP_000121460.1.31319 WP_000121460.1.31866 WP_000121460.1.33680 WP_000121460.1.35316 WP_000121460.1.35927 WP_000121460.1.37510 WP_000121460.1.37995 WP_000121460.1.38103 WP_000121460.1.38626 WP_000121460.1.39123 WP_000121460.1.41125 WP_000121460.1.41613 WP_000121460.1.42748 WP_000121460.1.42832 WP_000121460.1.4415 WP_000121460.1.46555 WP_000121460.1.47034 WP_000121460.1.48077 WP_000121460.1.48954 WP_000121460.1.49107 WP_000121460.1.49229 WP_000121460.1.49856 WP_000121460.1.50258 WP_000121460.1.51278 WP_000121460.1.54307 WP_000121460.1.5520 WP_000121460.1.58172 WP_000121460.1.60606 WP_000121460.1.61948 WP_000121460.1.64014 WP_000121460.1.682 WP_000121460.1.68609 WP_000121460.1.71113 WP_000121460.1.73075 WP_000121460.1.77608 WP_000121460.1.78775 WP_000121460.1.80141 WP_000121460.1.810 WP_000121460.1.81376 WP_000121460.1.81517 WP_000121460.1.82572 WP_000121460.1.84140 WP_000121460.1.84881 WP_000121460.1.86451 WP_000121460.1.88535 WP_000121460.1.89067 WP_000121460.1.91971 WP_000121460.1.93338 WP_000121460.1.94507 WP_000121460.1.96247 WP_000121460.1.97434 WP_000121460.1.9816 WP_000121460.1.98357 WP_000121460.1.98549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]