SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260871192|ref|YP_003237972.1| from Escherichia coli O111:H- str. 11128

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260871192|ref|YP_003237972.1|
Domain Number 1 Region: 747-1009
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.43e-65
Family N6 adenine-specific DNA methylase, DAM 0.0000214
Further Details:      
 
Domain Number 2 Region: 419-486,528-665,695-721
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.6e-38
Family C5 cytosine-specific DNA methylase, DCM 0.0053
Further Details:      
 
Domain Number 3 Region: 77-215,362-418
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 5.63e-16
Family Intein (protein splicing domain) 0.038
Further Details:      
 
Domain Number 4 Region: 2-78
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.0000000000941
Family C5 cytosine-specific DNA methylase, DCM 0.028
Further Details:      
 
Domain Number 5 Region: 282-369
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0000000157
Family Intein endonuclease 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|260871192|ref|YP_003237972.1|
Sequence length 1013
Comment putative DNA methyltransferase [Escherichia coli O111:H- str. 11128]
Sequence
MKELCYGSVCSGIEAASIAWEPLGMRPAWFAEIEPFPSAVLALRWPHVANLGDMKKLAKK
VLAGEIESPDVLVGGTPCFTAGHMVLCKNGYKPIENVCPGDYVVSHLGRLQQVKRVGSKI
ANTGLLNAVGQPLGIRTTNDHPFLAVRWKAQNTRKNGTYFKRELLSEPEWRAACDMPGYQ
WCALTNFNIAFPDICSRFLSEEQAMYLAGAYVGDGYIRRWRGKSKKAVVFGINCQKLRKF
HCRIPENIFSVASEIRGSIKVTLNDTCYANWLNEHFGELSHAKRIPAWVMSHPLRHVFLQ
GYLDTDGTPSGKAGFRINSVSSALAWGVAGLSQTCGYVSSVSFIEVEPKKVIEDRVVNQR
NYYQVTICPQKLSRKSRLAHGMLLRTVKEFKSVGLDTVYNIEVEGDHSYILNGAVVHNCQ
AFSIAGLRGGLDDERGALTLKYVELANAIDDKRAESFLKPAVIVWENVPGVLSSADNAFG
CFLAGLAGEDVPFEPGDRPESGKSNAFWRWDGKTGCHVPKWPQCGCIYGPQRKVAWRILD
AQYFGVAQRRRRVFVVASARTDLDPATVLFEFEGVRRNIAPSRGEGKETTRYTSNIAIRT
CDDTNIIAMAHGQGGAEIKTDNSAPTLTCNHEAPIVLLGDGRMRRLTPVECERLQGFPDW
HTLIPTEKRKKVNSDELAYLHNHYPDLSEEEAAMLAADGPRYKAIGNSMAIPVMRWIGDR
ITKAVCRQKEGSETKERKVKPAAEFERSIFKWAGGKFGVLEQIFRYLPEGKRLIEPFVGG
GAVFMNAGYQENLLNDVNADLINFYKTLQREAHSLITLAHRFFQDYNTQEGYLAVRNAFN
KQVYDDLHRAAAFLFLNRHCFNGLTRYNQAGEFNVGYGKYKTPYFPLQEMEAFLGAEGRS
EFVCGDFAAVIEAAGEGDVIFCDPPYEPLPNTEGFTNYSGHDFKFEEQKRLVSLLTDAHR
RGAKVLITNSGAPNIRELYHDSGFRVEPLFARRSVSCKGDTRGVAHDVLGILL
Download sequence
Identical sequences A0A152SPL1 C8UR62
gi|260871192|ref|YP_003237972.1| WP_000660980.1.101630 WP_000660980.1.102069 WP_000660980.1.18519 WP_000660980.1.23078 WP_000660980.1.29798 WP_000660980.1.29876 WP_000660980.1.32475 WP_000660980.1.41455 WP_000660980.1.41964 WP_000660980.1.42203 WP_000660980.1.44077 WP_000660980.1.51278 WP_000660980.1.52777 WP_000660980.1.53537 WP_000660980.1.56835 WP_000660980.1.64014 WP_000660980.1.64074 WP_000660980.1.66288 WP_000660980.1.73032 WP_000660980.1.73797 WP_000660980.1.88631 WP_000660980.1.9255 WP_000660980.1.95655 gi|260871192|ref|YP_003237972.1|NC_013370 585396.ECO111_p2-066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]