SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|288904288|ref|YP_003429509.1| from Streptococcus gallolyticus UCN34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288904288|ref|YP_003429509.1|
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.01e-35
Family Ribosomal protein L6 0.000053
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 3.4e-26
Family Ribosomal protein L6 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|288904288|ref|YP_003429509.1|
Sequence length 178
Comment 50S ribosomal protein L6 [Streptococcus gallolyticus UCN34]
Sequence
MSRIGNKVINLPAGVEVTNNDNVVTVKGPKGELTREFNKNIEIKVEGTEVSLHRPNDSKE
MKTIHGTARANLNNMVVGVSEGFKKELEMRGVGYRAQLQGSKLVLSVGKSHQDEVEAPEG
VSFEVPSATTIVVNGINKEVVGQTAAYIRSLRAPEPYKGKGIRYVGEYVRRKEGKTGK
Download sequence
Identical sequences A0A0E1XKR0 A0A139QND8 A0A1S5W9M9 F5WY53
gi|325977267|ref|YP_004286983.1| gi|288904288|ref|YP_003429509.1| WP_009853214.1.19369 WP_009853214.1.21549 WP_009853214.1.22697 WP_009853214.1.23942 WP_009853214.1.26722 WP_009853214.1.2742 WP_009853214.1.4451 WP_009853214.1.54120 WP_009853214.1.57133 WP_009853214.1.76930 WP_009853214.1.8633 WP_009853214.1.89126 WP_009853214.1.89533 gi|386336754|ref|YP_006032923.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]