SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288904324|ref|YP_003429545.1| from Streptococcus gallolyticus UCN34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288904324|ref|YP_003429545.1|
Domain Number 1 Region: 4-81,174-352
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.19e-58
Family Bacterial dinuclear zinc exopeptidases 0.00000876
Further Details:      
 
Domain Number 2 Region: 71-182
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.05e-25
Family Aminopeptidase/glucanase lid domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|288904324|ref|YP_003429545.1|
Sequence length 355
Comment glutamyl aminopeptidase [Streptococcus gallolyticus UCN34]
Sequence
MSELFSKIKEITELDSIAGYEHSVRNYLRSKITPLVDDVQTDGLGGIFGIKNSAAENAPR
IMVAAHMDEVGFMVSDIKADGTMRAVGIGGWNPLVLSSQRFTLYTRDGRAIPVVSGSVPP
HFLRGANGSAALPKIDDIIFDAGFTDKAEAESFGILPGDIIVPKSETILTANQKNVISKA
WDNRFGVLMVTESLESLKGQELDNTLIAGANVQEEVGLRGAHVSATKFQPELFFAVDCSP
AGDIYGNQGKIGDGTLFRFYDPGHIMLKDMRDFLLTTAEEAGIKYQYYAAKGGTDAGAAH
LKNGGIPSTTIGVCARYIHSHQSLYAMDDFLQAQAFLQAIVKKLDRSTVDLIKKY
Download sequence
Identical sequences A0A0E1XTI5 F5WY89
gi|386336790|ref|YP_006032959.1| gi|288904324|ref|YP_003429545.1| gi|325977319|ref|YP_004287035.1| WP_009853243.1.19369 WP_009853243.1.2742 WP_009853243.1.4451 WP_009853243.1.57133 WP_009853243.1.76930 WP_009853243.1.8633 WP_009853243.1.89533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]