SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288904372|ref|YP_003429593.1| from Streptococcus gallolyticus UCN34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288904372|ref|YP_003429593.1|
Domain Number 1 Region: 3-82,178-341
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 5.59e-53
Family Bacterial dinuclear zinc exopeptidases 0.000000774
Further Details:      
 
Domain Number 2 Region: 70-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.36e-29
Family Aminopeptidase/glucanase lid domain 0.00000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288904372|ref|YP_003429593.1|
Sequence length 345
Comment glutamyl aminopeptidase [Streptococcus gallolyticus UCN34]
Sequence
MKTTVDYITKLANIPSPTGYTSHIMNYVIAELESFGYAPARTNKGGVMVTVTGKNDSKHR
VVTAHLDTLGAMVRAVKPDGRLKMDLIGGFVYNAIEGENCTVHVSKNGKKISGTILMHQT
SVHVYKDAGTAERNQTNMEVRLDEKVTNEKETRALGIEVGDFISFDPRVVVTESGFIKSR
HLDDKVSAAILIELLKEYKAQNITLPYTTHFYFSAFEELGHGANSSIPVETVEYLSVDMG
AMGDDQQTDEYSVSICVKDGSGPYHYELRQHLVKLANDNKIPYKLDIYPYYGSDASAALR
AGAEVKHALFGAGIESSHSYERTHIDSVQATERLVDAYLKSPIVE
Download sequence
Identical sequences A0A0E1XTN6 A0A1S5W9B8 F5WYI1
gi|386336882|ref|YP_006033051.1| WP_009853288.1.19369 WP_009853288.1.2742 WP_009853288.1.4451 WP_009853288.1.54120 WP_009853288.1.57133 WP_009853288.1.76930 WP_009853288.1.8633 WP_009853288.1.89533 gi|288904372|ref|YP_003429593.1| gi|325977368|ref|YP_004287084.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]