SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288904892|ref|YP_003430114.1| from Streptococcus gallolyticus UCN34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288904892|ref|YP_003430114.1|
Domain Number 1 Region: 11-393
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.44e-136
Family ArgJ-like 0.00000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288904892|ref|YP_003430114.1|
Sequence length 397
Comment bifunctional ornithine acetyltransferase/N-acetylglutamate synthase [Streptococcus gallolyticus UCN34]
Sequence
MKVIEGNVASPLGFSADGLHAGFKKRKLDFGWIVSEVPASVAGVYTTNKVIAAPLIVTRN
SIKKAQKMKAIVVNSGVANSCTGVQGMEDAYTMQKWTAEKLGVEPDLVGIASTGVIGDLL
PMDTLKTGLSKLVVNGNSDDFSKAILTTDTMVKTVAVTEKFGRDEVTMAGVAKGSGMIHP
NMATMLAFITCDANISSETLQLALSQNVETTFNQITVDGDTSTNDMVLVLSNGCTLNEEI
LPDTPEFDKFSAMLNYVMQELAKKIAKDGEGASKLIEVNVKNAPNALDARMMAKSVVGSS
LVKTAIFGEDPNWGRILAAVGYAGVDVPVDNIDIYLGDIPVMLKSSPVDFEAEEMQDIMH
EDEITITVDLHSGEAVGKAWGCDLSYDYVKINALYRT
Download sequence
Identical sequences A0A139R338 A0A1S5WAZ8 F5WZU1
gi|386337342|ref|YP_006033511.1| gi|288904892|ref|YP_003430114.1| WP_012961682.1.22697 WP_012961682.1.4451 WP_012961682.1.54120 WP_012961682.1.57133 WP_012961682.1.76930 WP_012961682.1.8633 WP_012961682.1.89533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]