SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|288906117|ref|YP_003431339.1| from Streptococcus gallolyticus UCN34

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|288906117|ref|YP_003431339.1|
Domain Number 1 Region: 291-360,387-410,437-605,743-800
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.04e-55
Family Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain 0.00064
Further Details:      
 
Domain Number 2 Region: 1-172
Classification Level Classification E-value
Superfamily Flavoproteins 1.07e-38
Family NADPH-dependent FMN reductase 0.00059
Further Details:      
 
Domain Number 3 Region: 590-739
Classification Level Classification E-value
Superfamily Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 1.11e-34
Family Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|288906117|ref|YP_003431339.1|
Sequence length 804
Comment flavin oxidoreductase [Streptococcus gallolyticus UCN34]
Sequence
MKLVAIVGTNAKKSYNRLLLQYMARHFAKKADIEILEITDVPMFNETDDQTESAIIQEFN
SKITEADGVIIATPEHNHTIPSSLNSLLEWLSFNIHPLAGKPTMIVGASYDIQGSSRAQL
HLRQILDAPGVNATVMPGSEFLLGRVQTAFDENGDLKDQGTIDFLESCFFRFLRFATIAN
QLNEPEEVRFEPGTYQVTTVGHNGDLPMSVTLSEERIEAIDIDSSGETGGIADVVFTRIP
SEIIEGQTLNVDAVSGASVTSNGVLDGVARAVRQAGANPDALRSRPKAPSALDKEDRTYD
TELVVVGGGGAGLAAAARALQAGKKVVVVEKFPSVGGNTVRAGGPMNAPDPAWQNTFAAN
PGEANTLQELHDIDEATIDPEFIDDFRALKVEIEEYLKDSTYLFDSKLLYRIQTYLGGKR
KDLKGNEIHGNYQLISVLTERALESVRWLENIGVEFVRDEVTMPVGALWRRGHKPKVPMG
VAFISVLKDFVLKNGGIILTDTQVKELLITDGIVTGVKGIGRNGQTITVNGKAVILTTGG
FGANTKMLQQYNTYWSEIDDDIATSNTPAATGDGILLGQSVGADLVGMGFSQMMPVSDPV
TGALFSGLQVPPANFIMVNTKGKRFVDEYGSRDQLSQAAIDNGGLFYLIADENIKETAYN
TSQEKIDAQVEAGTLFRADTLEELAEQINIDPAVLVETITNYNSYVDAGHDPEFDKGAFD
LKVEKAPFYATPRKPAVHHTMGGLKIDTKAHVINENGQTIKGLFAAGEVAGGLHAGNRLG
GNSLTDIFTFGRIATDTAIAEYLG
Download sequence
Identical sequences A0A139NDL7 F5WWW2
WP_012962470.1.21549 WP_012962470.1.4451 WP_012962470.1.89533 gi|386338559|ref|YP_006034728.1| gi|288906117|ref|YP_003431339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]