SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290955002|ref|YP_003486184.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290955002|ref|YP_003486184.1|
Domain Number 1 Region: 279-419
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 2.22e-32
Family Oxidoreductase molybdopterin-binding domain 0.00044
Further Details:      
 
Domain Number 2 Region: 30-190
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0000014
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290955002|ref|YP_003486184.1|
Sequence length 420
Comment hypothetical protein SCAB_4081 [Streptomyces scabiei 87.22]
Sequence
MQRSPSSPAFWRSPLRGPWFTSLLGLVLLAGITVLFVTGLLSYAAYNPDLSPVNDKTPDK
GLLGFYLFPWPTNPHWLYRLTQGVHVTLGIALVPVLLAKLWSVVPRLFQLPPARSVAHAL
ERISLLLLVGGVLFEFVTGVLNVQLDYVFPGSFYPLHFYGAWVFVAAFVVHVVLRGPAAV
RNLRRMRAGEAAGVPPVESPEEPSLVSPDPAEPTVSRRGAVWLVGGGSLLLLGTTVGQTV
DGPLRRTALLAPHGGPEPGGGPNGFQINKTAASRGISPAETSEEAWRLVVTGPSGTVRLS
RAELLELPQHSAALPIACVEGWSTSDQWWRGVRLADLAALVGHPVGAAPDVLVESLQRHG
AFRRAALRANQVRDPRSLLALDVNGERLSPDHGHPARIIVPAAPGVLNTKWVARMTFGDL
Download sequence
Identical sequences C9YST8
gi|290955002|ref|YP_003486184.1| WP_012998350.1.11737 WP_012998350.1.12502 WP_012998350.1.57887 WP_012998350.1.93747 WP_012998350.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]