SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290955903|ref|YP_003487085.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|290955903|ref|YP_003487085.1|
Domain Number - Region: 130-197
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000146
Family PriA-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290955903|ref|YP_003487085.1|
Sequence length 336
Comment hypothetical protein SCAB_13581 [Streptomyces scabiei 87.22]
Sequence
MGEAVELEAAGRTVRLSSPGKIFFPERGFTKLDLARYYIAVGPGILRALRDRPTTLERYP
EGVAGENFFQKRAPKNMPDWIPTAHITFPSGRSADEMCPTEVAAVVWAAQFGTLTFHPWP
VRRADVDRPDELRIDLDPQPGTDYGDAVRAAHELREVLHEYGGLRGWPKTSGGRGLHVFV
PIRPDWTFTQVRRSAIAVARELERRMPEQVTTAWWKEERGAKIFVDYNQTARDRTIASAY
SVRPHPHAPVSAPLTWDEVGAAVPRDFDLGTMPSRFAEVGDVHADMDEHAFSLEALLELA
ARDEHDHGLGDLPYPPEYPKMPGEPKRVQPSRARKG
Download sequence
Identical sequences C9Z887
WP_012999245.1.11737 WP_012999245.1.12502 WP_012999245.1.15999 WP_012999245.1.2165 WP_012999245.1.32552 WP_012999245.1.57887 WP_012999245.1.82449 WP_012999245.1.93747 WP_012999245.1.94791 gi|290955903|ref|YP_003487085.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]