SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290957349|ref|YP_003488531.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290957349|ref|YP_003488531.1|
Domain Number 1 Region: 244-511,571-615
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.34e-78
Family Type II chitinase 0.00000439
Further Details:      
 
Domain Number 2 Region: 41-142
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6e-31
Family Cellulose-binding domain family II 0.00027
Further Details:      
 
Domain Number 3 Region: 152-231
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-16
Family Fibronectin type III 0.00032
Further Details:      
 
Domain Number 4 Region: 513-572
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000564
Family Chitinase insertion domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290957349|ref|YP_003488531.1|
Sequence length 616
Comment chitinase C protein [Streptomyces scabiei 87.22]
Sequence
MLKTPHKEAHMRFRHRFTAGLATLLLPLFGLVGLATPAHAATEATATYAKPQDWGSGFEG
KWTVKNTGTTTIGSWTVEWDFPSGTSVTSAWDADVTSSGTHWTAKNKSWNGSLAPGASVS
FGFNGSGSGSPSNCKLNGGSCDGGPSVPGDAAPSAPGTPTASDVTSTSVKLSWSAATDDK
GVKNYDVLRGGTKVATVTGTTYTDTGLSAGTDYSYTVQARDTADQTGPLSGAAAVRTTGG
TNPNPGSKINLGYFTEWGVYGRNYHVKNLVTSGSASKITHINYAFGNVKNGQCTVDDTYA
AYDKAYTADQSVSGTADTWDQPLRGNFNQLRQLKAKYPHIKVLYSFGGWTYSGGFGQAAQ
NPAAFAKSCKAVVEDPRWADVFDGIDIDWEYPNACGLTCDTSGPAAFKNLMSALRTEFGA
NYLVTAAITADGSSGGKIDAADYGGAATHLNWYNVMTYDYFGAFDADGPTAPHSPLTSYP
GIPAAGFNSADAIAKLKAKGVPGAKLLLGIGFYGRGWTGVTQSTPGGTATGAAPGTYEAG
IEDYKILKNSCPANGTVGGTAYAHCGNQWWSYDTPATIGSKMTWAKNQGLGGAFFWEFSG
DTGNGELVSAISNGLK
Download sequence
Identical sequences C9Z8E5
gi|290957349|ref|YP_003488531.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]