SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290959765|ref|YP_003490947.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290959765|ref|YP_003490947.1|
Domain Number 1 Region: 10-198
Classification Level Classification E-value
Superfamily Prim-pol domain 1.7e-30
Family Bifunctional DNA primase/polymerase N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290959765|ref|YP_003490947.1|
Sequence length 301
Comment hypothetical protein SCAB_53671 [Streptomyces scabiei 87.22]
Sequence
MTHDPRPALLRAALDAAARGWPVIPLRPRSKVPALHGERRCPHSGDCAGGHRTFEQRATL
DPARIERCWSSGPFNVGIATGPAGLLVVDLDTLKPTDEAGTPDGAANFQALCERAGHTVP
ATRRIRTPSGGEHLYFTAPSGVRFANTTGTLTPKVDTRAWGGQVVAPGSITPHGPYTVLD
DQPVANLSEWLQKALTASQRRATAPILPTLARDADRYAAAVLNREVAAVAATGEGGRQAE
LLRAVRAVGRFVAWGDLDRATVETAFTCGGESAGLSPAECRNTIRKALDYSIRTAWPRRT
A
Download sequence
Identical sequences C9YWL9
gi|290959765|ref|YP_003490947.1| WP_013002984.1.11737 WP_013002984.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]