SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290960007|ref|YP_003491189.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|290960007|ref|YP_003491189.1|
Domain Number - Region: 77-152
Classification Level Classification E-value
Superfamily Prim-pol domain 0.0471
Family Bifunctional DNA primase/polymerase N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290960007|ref|YP_003491189.1|
Sequence length 281
Comment hypothetical protein SCAB_56211 [Streptomyces scabiei 87.22]
Sequence
MTQPTPLRRALALAAHGVPALPLRAGKAPFGNCPTCAGNACGGRPNMKTPGPCTCPRPCH
GWAAATTDAYVLTSPPWAPAWRRAAAVAYHPGGAGVTVVDLDNAAAVDWARATLPTTRTV
PTTRGEHWTYRGVMRSVNGVREGVDIKSTMSYTRWLGPGVGATAALPDAVRALAVREPFP
SRRAPQALTVPPRGGQGECPHRTPTYLDRGVAMAEQRITEARSAVHATVYRTFLAVLSTH
GRCGCLTDTHVNRLFTAAQAKGESVRHCTDAWSNALTTLGL
Download sequence
Identical sequences C9Z138
WP_013003218.1.11737 WP_013003218.1.94791 gi|290960007|ref|YP_003491189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]