SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290960622|ref|YP_003491804.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290960622|ref|YP_003491804.1|
Domain Number 1 Region: 58-108,249-487
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.52e-64
Family Bacterial dinuclear zinc exopeptidases 0.000017
Further Details:      
 
Domain Number 2 Region: 141-231
Classification Level Classification E-value
Superfamily PA domain 1.14e-16
Family PA domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290960622|ref|YP_003491804.1|
Sequence length 525
Comment aminopeptidase [Streptomyces scabiei 87.22]
Sequence
MNASPKASPRSRRPVAAIAALALAAPLLIVSAGTADADSNDSKPAKDAKKLSRKLVRESS
TKDAYKHLKALQAIADANGGNRAAGTPGHDKSAEYVYKVLKKAGYKVSYDTFEFAYIETL
AEKASVLSPTPRGLGIAAMTYTKSTPVGGITAPLAAAAVDATSGCEAGDYAAGAFTGKIA
LIKRGGCTFAQKQLVASEAGAVGAIIYNNTAGALAGTLGDPASAKIPTAGLSQAEGEALA
ADVAAGVVTVGFEVRQLQENRTSKNVMAETPGGDADSTVMVGAHLDSVTAGPGINDNGSG
SAGILEVAEELAENLKPGKQQPNKVKFAFWSAEELGLVGSESYVERLTEQQREQIKLYLN
FDMIASPNHAQFVYDGDDSDGVGAGPGPEGSAQLERDINRFLDSKGEPHEGTDFSGRSDY
GPFIAVGIPSGGTFTGAEGIKTANQAAVFGGTAGVAYDACYHAACDNLKNISMKAFGINI
GVIANAVGTYTHDLSSLAEPVASKPTTGGDTSGGGLHSDHDEVAE
Download sequence
Identical sequences C9ZAW6
gi|290960622|ref|YP_003491804.1| WP_013003825.1.11737 WP_013003825.1.57887 WP_013003825.1.93747 WP_013003825.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]