SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290961775|ref|YP_003492957.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|290961775|ref|YP_003492957.1|
Domain Number - Region: 11-80
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0549
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|290961775|ref|YP_003492957.1|
Sequence length 119
Comment hypothetical protein SCAB_74391 [Streptomyces scabiei 87.22]
Sequence
MLVPLTVTTAVAALLLAAWCGWAAYRDQPTKDWHFIGMAVVSVLALVQLVVGIVQLARGE
KPEQGTTIFVSYLLGAFACVPVTGFMSLAERTRWGSVTVAAGGVVLAVLQVRLYDIWGG
Download sequence
Identical sequences A0A100JRM7 C9Z5Z6
gi|290961775|ref|YP_003492957.1| WP_013004961.1.11737 WP_013004961.1.12502 WP_013004961.1.15999 WP_013004961.1.2165 WP_013004961.1.21818 WP_013004961.1.32552 WP_013004961.1.36687 WP_013004961.1.57887 WP_013004961.1.82449 WP_013004961.1.93747 WP_013004961.1.94791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]