SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290961904|ref|YP_003493086.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|290961904|ref|YP_003493086.1|
Domain Number 1 Region: 33-296,356-393
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.12e-83
Family Type II chitinase 0.00000332
Further Details:      
 
Domain Number 2 Region: 298-357
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000055
Family Chitinase insertion domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|290961904|ref|YP_003493086.1|
Sequence length 397
Comment chitinase/cellulase [Streptomyces scabiei 87.22]
Sequence
MLRRARRRTPRRSGHRDRHARAARTAGPGPGAPHSKVVGYFIDWGIYGRQYYVKNIETSG
SAKKLTHINYAFGNVVDGKCAIGDPWADADRPFSAEESVDGVADSADQPLSGSFNQLRKL
KKLHPNLKIVWSFGGWTWSGGFGEAAKDPAAFADSCYDLVENSRWQDVFDGIDIDWEYPN
ACGLTCDTSGPEAFEDVMAALRKRFGKKELVTAAITADAKKGGKIDAADYAGAAKYVDWY
NPMTYDYFGSWDTTTAPHSPLYPYPGIADRSFNTAATIKKLKSLGIPSSKLLLGIGFYGR
GWTGVTRSAPGGTATGPAAGTYEAGYEDYKVLKKTCPANGVVGGTAYAKCGDDWWSYDTP
RTIKGKMAYKNAQGLGGTFFWELSGDTPDGELIRAIK
Download sequence
Identical sequences C9Z7Q2
gi|290961904|ref|YP_003493086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]