SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|290963365|ref|YP_003494547.1| from Streptomyces scabiei 87.22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|290963365|ref|YP_003494547.1|
Domain Number - Region: 3-48
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0989
Family Chitinase insertion domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|290963365|ref|YP_003494547.1|
Sequence length 96
Comment hypothetical protein SCAB_90941 [Streptomyces scabiei 87.22]
Sequence
MTDHPRKGTVAAPGSPGFALHTLGWRAFQDLCAAVLREVWAQSVHTFADSNDGGRDGAFY
GTWQQPPDPIGVQDVPDGPFVLQCKHTKKADTTLTP
Download sequence
Identical sequences C9Z9U8
WP_012998007.1.11737 WP_012998007.1.94791 gi|290954643|ref|YP_003485825.1| gi|290963365|ref|YP_003494547.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]