SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479054907|ref|YP_007350713.1| from Mycobacterium tuberculosis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479054907|ref|YP_007350713.1|
Domain Number 1 Region: 14-212
Classification Level Classification E-value
Superfamily Formyltransferase 4.71e-54
Family Formyltransferase 0.0000414
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479054907|ref|YP_007350713.1|
Sequence length 215
Comment putative 5'-PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE PURN (GART) (GAR TRANSFORMYLASE) (5'-PHOSPHORIBOSYLGLYCINAMIDE TRANSFORMYLASE) [Mycobacterium tuberculosis 7199-99]
Sequence
MQEPLRVPPSAPARLVVLASGTGSLLRSLLDAAVGDYPARVVAVGVDRECRAAEIAAEAS
VPVFTVRLADHPSRDAWDVAITAATAAHEPDLVVSAGFMRILGPQFLSRFYGRTLNTHPA
LLPAFPGTHGVADALAYGVKVTGATVHLVDAGTDTGPILAQQPVPVLDGDDEETLHERIK
VTERRLLVAAVAALATHGVTVVGRTATMGRKVTIG
Download sequence
Identical sequences A0A045IXB2 A0A083WF73 A0A0H3M967 A0A0Y1C0Z8 A0A109SLM5 A0A109SV87 A0A197IZ82 A0A1R3XWY5 A0A1S1BD15 A5U0Z6 F8M4K1 I6Y590 P9WHM4 P9WHM5 R4M492
gi|383306842|ref|YP_005359653.1| gi|253800017|ref|YP_003033018.1| Rv0956 gi|15608096|ref|NP_215471.1| gi|494699348|ref|YP_007964830.1| gi|385997736|ref|YP_005916034.1| gi|506925392|ref|YP_008005842.1| gi|375297254|ref|YP_005101521.1| gi|121636881|ref|YP_977104.1| gi|15840380|ref|NP_335417.1| gi|392385665|ref|YP_005307294.1| gi|479313843|ref|YP_007853895.1| gi|378770715|ref|YP_005170448.1| gi|449062999|ref|YP_007430082.1| gi|15608096|ref|NP_215471.1| gi|148660735|ref|YP_001282258.1| gi|31792145|ref|NP_854638.1| gi|148822165|ref|YP_001286919.1| gi|506925392|ref|YP_008005842.1| gi|392433457|ref|YP_006474501.1| gi|525673734|ref|YP_008225056.1| gi|494695352|ref|YP_007960855.1| NP_215471.1.84033 WP_003898661.1.100000 WP_003898661.1.100021 WP_003898661.1.100069 WP_003898661.1.100087 WP_003898661.1.10015 WP_003898661.1.100208 WP_003898661.1.100216 WP_003898661.1.10022 WP_003898661.1.100255 WP_003898661.1.100260 WP_003898661.1.100270 WP_003898661.1.100279 WP_003898661.1.100286 WP_003898661.1.100308 WP_003898661.1.100309 WP_003898661.1.100318 WP_003898661.1.100338 WP_003898661.1.10037 WP_003898661.1.100383 WP_003898661.1.100395 WP_003898661.1.100396 WP_003898661.1.1004 WP_003898661.1.100401 WP_003898661.1.100459 WP_003898661.1.100460 WP_003898661.1.100552 WP_003898661.1.100581 WP_003898661.1.100600 WP_003898661.1.100625 WP_003898661.1.10064 WP_003898661.1.100666 WP_003898661.1.100671 WP_003898661.1.100677 WP_003898661.1.100697 WP_003898661.1.100703 WP_003898661.1.100716 WP_003898661.1.100722 WP_003898661.1.100754 WP_003898661.1.100757 WP_003898661.1.100772 WP_003898661.1.1008 WP_003898661.1.100812 WP_003898661.1.100845 WP_003898661.1.100866 WP_003898661.1.10088 WP_003898661.1.100889 WP_003898661.1.10090 WP_003898661.1.100915 WP_003898661.1.100918 WP_003898661.1.100935 WP_003898661.1.100984 WP_003898661.1.100992 WP_003898661.1.100998 WP_003898661.1.101 WP_003898661.1.101025 WP_003898661.1.101028 WP_003898661.1.10104 WP_003898661.1.101048 WP_003898661.1.101054 WP_003898661.1.101075 WP_003898661.1.101146 WP_003898661.1.10116 WP_003898661.1.10117 WP_003898661.1.101209 WP_003898661.1.10125 WP_003898661.1.101290 WP_003898661.1.101323 WP_003898661.1.101324 WP_003898661.1.101350 WP_003898661.1.101367 WP_003898661.1.101398 WP_003898661.1.101403 WP_003898661.1.101421 WP_003898661.1.10144 WP_003898661.1.101442 WP_003898661.1.10145 WP_003898661.1.101452 WP_003898661.1.101456 WP_003898661.1.101481 WP_003898661.1.101493 WP_003898661.1.101496 WP_003898661.1.101525 WP_003898661.1.101533 WP_003898661.1.101535 WP_003898661.1.101553 WP_003898661.1.101558 WP_003898661.1.10156 WP_003898661.1.101573 WP_003898661.1.101576 WP_003898661.1.10159 WP_003898661.1.101592 WP_003898661.1.101604 WP_003898661.1.101607 WP_003898661.1.101622 WP_003898661.1.101644 WP_003898661.1.101659 WP_003898661.1.101671 WP_003898661.1.101687 WP_003898661.1.101698 WP_003898661.1.101713 WP_003898661.1.101722 WP_003898661.1.101733 WP_003898661.1.101743 WP_003898661.1.101754 WP_003898661.1.101795 WP_003898661.1.101797 WP_003898661.1.101798 WP_003898661.1.101802 WP_003898661.1.101826 WP_003898661.1.101836 WP_003898661.1.101858 WP_003898661.1.101859 WP_003898661.1.101862 WP_003898661.1.101888 WP_003898661.1.101899 WP_003898661.1.1019 WP_003898661.1.101923 WP_003898661.1.101925 WP_003898661.1.10193 WP_003898661.1.101996 WP_003898661.1.102 WP_003898661.1.102008 WP_003898661.1.102017 WP_003898661.1.102053 WP_003898661.1.102055 WP_003898661.1.102063 WP_003898661.1.102099 WP_003898661.1.1021 WP_003898661.1.10211 WP_003898661.1.102121 WP_003898661.1.102143 WP_003898661.1.10216 WP_003898661.1.10224 WP_003898661.1.10253 WP_003898661.1.10262 WP_003898661.1.10272 WP_003898661.1.10277 WP_003898661.1.1033 WP_003898661.1.10350 WP_003898661.1.10362 WP_003898661.1.10366 WP_003898661.1.10376 WP_003898661.1.10396 WP_003898661.1.10410 WP_003898661.1.10414 WP_003898661.1.10421 WP_003898661.1.10430 WP_003898661.1.1044 WP_003898661.1.10440 WP_003898661.1.10471 WP_003898661.1.10472 WP_003898661.1.10489 WP_003898661.1.105 WP_003898661.1.10523 WP_003898661.1.10545 WP_003898661.1.1057 WP_003898661.1.10603 WP_003898661.1.10606 WP_003898661.1.10615 WP_003898661.1.10623 WP_003898661.1.10635 WP_003898661.1.10648 WP_003898661.1.10662 WP_003898661.1.10735 WP_003898661.1.10756 WP_003898661.1.1078 WP_003898661.1.10791 WP_003898661.1.10799 WP_003898661.1.10825 WP_003898661.1.10848 WP_003898661.1.10863 WP_003898661.1.10879 WP_003898661.1.10912 WP_003898661.1.10916 WP_003898661.1.10923 WP_003898661.1.10927 WP_003898661.1.1095 WP_003898661.1.10956 WP_003898661.1.10958 WP_003898661.1.10962 WP_003898661.1.10980 WP_003898661.1.10981 WP_003898661.1.10993 WP_003898661.1.1100 WP_003898661.1.11040 WP_003898661.1.11061 WP_003898661.1.11141 WP_003898661.1.11171 WP_003898661.1.11175 WP_003898661.1.11176 WP_003898661.1.11222 WP_003898661.1.11236 WP_003898661.1.11329 WP_003898661.1.1133 WP_003898661.1.11342 WP_003898661.1.11373 WP_003898661.1.11376 WP_003898661.1.11390 WP_003898661.1.11402 WP_003898661.1.11481 WP_003898661.1.11487 WP_003898661.1.11489 WP_003898661.1.11514 WP_003898661.1.11587 WP_003898661.1.11589 WP_003898661.1.11596 WP_003898661.1.11604 WP_003898661.1.11610 WP_003898661.1.11697 WP_003898661.1.11707 WP_003898661.1.11752 WP_003898661.1.11758 WP_003898661.1.11761 WP_003898661.1.11775 WP_003898661.1.11804 WP_003898661.1.11822 WP_003898661.1.11826 WP_003898661.1.11898 WP_003898661.1.11906 WP_003898661.1.11939 WP_003898661.1.11960 WP_003898661.1.11961 WP_003898661.1.11972 WP_003898661.1.11984 WP_003898661.1.120 WP_003898661.1.12049 WP_003898661.1.12052 WP_003898661.1.12100 WP_003898661.1.12116 WP_003898661.1.12133 WP_003898661.1.12161 WP_003898661.1.12165 WP_003898661.1.12184 WP_003898661.1.12187 WP_003898661.1.12190 WP_003898661.1.12216 WP_003898661.1.12265 WP_003898661.1.12275 WP_003898661.1.12293 WP_003898661.1.12294 WP_003898661.1.123 WP_003898661.1.1231 WP_003898661.1.12314 WP_003898661.1.12327 WP_003898661.1.12338 WP_003898661.1.1236 WP_003898661.1.12371 WP_003898661.1.12372 WP_003898661.1.12389 WP_003898661.1.12406 WP_003898661.1.1241 WP_003898661.1.12421 WP_003898661.1.12424 WP_003898661.1.12446 WP_003898661.1.12464 WP_003898661.1.12479 WP_003898661.1.12519 WP_003898661.1.12523 WP_003898661.1.12526 WP_003898661.1.1255 WP_003898661.1.12550 WP_003898661.1.12551 WP_003898661.1.12563 WP_003898661.1.12611 WP_003898661.1.12669 WP_003898661.1.1267 WP_003898661.1.12672 WP_003898661.1.12692 WP_003898661.1.1271 WP_003898661.1.12710 WP_003898661.1.12768 WP_003898661.1.1279 WP_003898661.1.12794 WP_003898661.1.12801 WP_003898661.1.12804 WP_003898661.1.12821 WP_003898661.1.12841 WP_003898661.1.12854 WP_003898661.1.12871 WP_003898661.1.12901 WP_003898661.1.12941 WP_003898661.1.12947 WP_003898661.1.12957 WP_003898661.1.12972 WP_003898661.1.13028 WP_003898661.1.13043 WP_003898661.1.13086 WP_003898661.1.13087 WP_003898661.1.13090 WP_003898661.1.13096 WP_003898661.1.13163 WP_003898661.1.13175 WP_003898661.1.13183 WP_003898661.1.132 WP_003898661.1.13249 WP_003898661.1.13282 WP_003898661.1.13284 WP_003898661.1.13296 WP_003898661.1.13298 WP_003898661.1.13302 WP_003898661.1.13306 WP_003898661.1.13312 WP_003898661.1.13313 WP_003898661.1.13321 WP_003898661.1.13345 WP_003898661.1.13358 WP_003898661.1.13370 WP_003898661.1.13375 WP_003898661.1.1338 WP_003898661.1.13420 WP_003898661.1.13433 WP_003898661.1.13435 WP_003898661.1.13438 WP_003898661.1.13461 WP_003898661.1.13466 WP_003898661.1.13489 WP_003898661.1.13551 WP_003898661.1.13564 WP_003898661.1.13579 WP_003898661.1.13647 WP_003898661.1.13687 WP_003898661.1.13697 WP_003898661.1.13719 WP_003898661.1.13763 WP_003898661.1.1377 WP_003898661.1.13774 WP_003898661.1.13786 WP_003898661.1.13793 WP_003898661.1.13794 WP_003898661.1.13817 WP_003898661.1.13834 WP_003898661.1.13866 WP_003898661.1.13880 WP_003898661.1.13899 WP_003898661.1.13909 WP_003898661.1.13910 WP_003898661.1.13919 WP_003898661.1.13920 WP_003898661.1.13952 WP_003898661.1.13953 WP_003898661.1.13962 WP_003898661.1.1398 WP_003898661.1.13988 WP_003898661.1.14027 WP_003898661.1.14046 WP_003898661.1.14115 WP_003898661.1.14152 WP_003898661.1.14158 WP_003898661.1.14162 WP_003898661.1.14175 WP_003898661.1.14178 WP_003898661.1.14194 WP_003898661.1.14195 WP_003898661.1.14208 WP_003898661.1.14238 WP_003898661.1.14266 WP_003898661.1.14303 WP_003898661.1.14306 WP_003898661.1.14307 WP_003898661.1.14310 WP_003898661.1.14382 WP_003898661.1.14416 WP_003898661.1.14428 WP_003898661.1.14441 WP_003898661.1.14469 WP_003898661.1.14477 WP_003898661.1.14504 WP_003898661.1.14514 WP_003898661.1.1452 WP_003898661.1.14527 WP_003898661.1.1454 WP_003898661.1.14544 WP_003898661.1.14548 WP_003898661.1.14551 WP_003898661.1.14561 WP_003898661.1.14573 WP_003898661.1.1462 WP_003898661.1.14658 WP_003898661.1.14667 WP_003898661.1.14668 WP_003898661.1.14675 WP_003898661.1.14694 WP_003898661.1.14695 WP_003898661.1.14709 WP_003898661.1.14766 WP_003898661.1.14783 WP_003898661.1.14865 WP_003898661.1.14872 WP_003898661.1.14905 WP_003898661.1.14926 WP_003898661.1.14951 WP_003898661.1.14955 WP_003898661.1.15003 WP_003898661.1.15009 WP_003898661.1.15028 WP_003898661.1.15040 WP_003898661.1.15052 WP_003898661.1.15065 WP_003898661.1.15072 WP_003898661.1.15089 WP_003898661.1.1509 WP_003898661.1.15126 WP_003898661.1.15131 WP_003898661.1.15168 WP_003898661.1.15172 WP_003898661.1.15174 WP_003898661.1.15187 WP_003898661.1.15196 WP_003898661.1.15210 WP_003898661.1.15216 WP_003898661.1.15217 WP_003898661.1.1523 WP_003898661.1.15232 WP_003898661.1.15238 WP_003898661.1.15240 WP_003898661.1.15253 WP_003898661.1.15267 WP_003898661.1.1527 WP_003898661.1.15292 WP_003898661.1.15299 WP_003898661.1.15302 WP_003898661.1.15322 WP_003898661.1.1534 WP_003898661.1.15345 WP_003898661.1.15365 WP_003898661.1.15372 WP_003898661.1.15386 WP_003898661.1.15387 WP_003898661.1.15442 WP_003898661.1.15447 WP_003898661.1.15449 WP_003898661.1.15477 WP_003898661.1.15481 WP_003898661.1.15492 WP_003898661.1.15511 WP_003898661.1.15512 WP_003898661.1.15558 WP_003898661.1.15559 WP_003898661.1.15566 WP_003898661.1.15599 WP_003898661.1.1560 WP_003898661.1.15611 WP_003898661.1.1563 WP_003898661.1.15633 WP_003898661.1.15643 WP_003898661.1.15688 WP_003898661.1.15755 WP_003898661.1.15763 WP_003898661.1.15774 WP_003898661.1.1578 WP_003898661.1.15780 WP_003898661.1.15827 WP_003898661.1.15834 WP_003898661.1.15842 WP_003898661.1.15848 WP_003898661.1.15853 WP_003898661.1.15877 WP_003898661.1.15893 WP_003898661.1.15896 WP_003898661.1.15926 WP_003898661.1.15933 WP_003898661.1.15946 WP_003898661.1.15958 WP_003898661.1.15973 WP_003898661.1.15987 WP_003898661.1.15993 WP_003898661.1.16009 WP_003898661.1.16025 WP_003898661.1.16043 WP_003898661.1.16055 WP_003898661.1.16066 WP_003898661.1.16069 WP_003898661.1.16077 WP_003898661.1.16106 WP_003898661.1.16108 WP_003898661.1.16110 WP_003898661.1.16136 WP_003898661.1.16139 WP_003898661.1.16141 WP_003898661.1.16143 WP_003898661.1.1630 WP_003898661.1.16318 WP_003898661.1.1632 WP_003898661.1.16327 WP_003898661.1.16334 WP_003898661.1.16341 WP_003898661.1.16345 WP_003898661.1.16374 WP_003898661.1.16384 WP_003898661.1.16386 WP_003898661.1.164 WP_003898661.1.1642 WP_003898661.1.16421 WP_003898661.1.16424 WP_003898661.1.16426 WP_003898661.1.16431 WP_003898661.1.16438 WP_003898661.1.1644 WP_003898661.1.16442 WP_003898661.1.16448 WP_003898661.1.16451 WP_003898661.1.16480 WP_003898661.1.16494 WP_003898661.1.1652 WP_003898661.1.16549 WP_003898661.1.16560 WP_003898661.1.16598 WP_003898661.1.16609 WP_003898661.1.16619 WP_003898661.1.16620 WP_003898661.1.16622 WP_003898661.1.16637 WP_003898661.1.1669 WP_003898661.1.16707 WP_003898661.1.16724 WP_003898661.1.16731 WP_003898661.1.1683 WP_003898661.1.16837 WP_003898661.1.16852 WP_003898661.1.16937 WP_003898661.1.16940 WP_003898661.1.16950 WP_003898661.1.16959 WP_003898661.1.16968 WP_003898661.1.1697 WP_003898661.1.16973 WP_003898661.1.16977 WP_003898661.1.16987 WP_003898661.1.17005 WP_003898661.1.17006 WP_003898661.1.17010 WP_003898661.1.17015 WP_003898661.1.17019 WP_003898661.1.17039 WP_003898661.1.17041 WP_003898661.1.17052 WP_003898661.1.17057 WP_003898661.1.17062 WP_003898661.1.1707 WP_003898661.1.17094 WP_003898661.1.17130 WP_003898661.1.17138 WP_003898661.1.17147 WP_003898661.1.17167 WP_003898661.1.17224 WP_003898661.1.17251 WP_003898661.1.17288 WP_003898661.1.17304 WP_003898661.1.17314 WP_003898661.1.17345 WP_003898661.1.17381 WP_003898661.1.17391 WP_003898661.1.17412 WP_003898661.1.1743 WP_003898661.1.17440 WP_003898661.1.17466 WP_003898661.1.17477 WP_003898661.1.17483 WP_003898661.1.17505 WP_003898661.1.17527 WP_003898661.1.17540 WP_003898661.1.17553 WP_003898661.1.17558 WP_003898661.1.17599 WP_003898661.1.17635 WP_003898661.1.17655 WP_003898661.1.17679 WP_003898661.1.1768 WP_003898661.1.17687 WP_003898661.1.17700 WP_003898661.1.17710 WP_003898661.1.17713 WP_003898661.1.17722 WP_003898661.1.17746 WP_003898661.1.17798 WP_003898661.1.17803 WP_003898661.1.17816 WP_003898661.1.17821 WP_003898661.1.17830 WP_003898661.1.17868 WP_003898661.1.17878 WP_003898661.1.1792 WP_003898661.1.17923 WP_003898661.1.1795 WP_003898661.1.17955 WP_003898661.1.17973 WP_003898661.1.18009 WP_003898661.1.18013 WP_003898661.1.18033 WP_003898661.1.18057 WP_003898661.1.18065 WP_003898661.1.18070 WP_003898661.1.18116 WP_003898661.1.18120 WP_003898661.1.18126 WP_003898661.1.1817 WP_003898661.1.18170 WP_003898661.1.18206 WP_003898661.1.18216 WP_003898661.1.18240 WP_003898661.1.18257 WP_003898661.1.18297 WP_003898661.1.18306 WP_003898661.1.18364 WP_003898661.1.18399 WP_003898661.1.18411 WP_003898661.1.18444 WP_003898661.1.18448 WP_003898661.1.18467 WP_003898661.1.18476 WP_003898661.1.18522 WP_003898661.1.18580 WP_003898661.1.18582 WP_003898661.1.18587 WP_003898661.1.186 WP_003898661.1.18601 WP_003898661.1.18639 WP_003898661.1.18646 WP_003898661.1.18647 WP_003898661.1.1868 WP_003898661.1.18694 WP_003898661.1.18710 WP_003898661.1.18751 WP_003898661.1.18781 WP_003898661.1.18793 WP_003898661.1.18804 WP_003898661.1.18816 WP_003898661.1.18823 WP_003898661.1.18838 WP_003898661.1.18849 WP_003898661.1.18856 WP_003898661.1.18945 WP_003898661.1.1898 WP_003898661.1.19005 WP_003898661.1.19056 WP_003898661.1.19071 WP_003898661.1.19085 WP_003898661.1.19094 WP_003898661.1.19144 WP_003898661.1.19159 WP_003898661.1.19193 WP_003898661.1.19231 WP_003898661.1.19243 WP_003898661.1.19264 WP_003898661.1.19295 WP_003898661.1.19307 WP_003898661.1.19326 WP_003898661.1.1933 WP_003898661.1.19364 WP_003898661.1.19382 WP_003898661.1.19400 WP_003898661.1.19426 WP_003898661.1.19429 WP_003898661.1.19464 WP_003898661.1.19553 WP_003898661.1.19562 WP_003898661.1.19564 WP_003898661.1.19568 WP_003898661.1.19572 WP_003898661.1.19596 WP_003898661.1.19600 WP_003898661.1.19630 WP_003898661.1.1967 WP_003898661.1.19694 WP_003898661.1.1970 WP_003898661.1.19707 WP_003898661.1.19742 WP_003898661.1.19785 WP_003898661.1.19820 WP_003898661.1.19868 WP_003898661.1.19874 WP_003898661.1.19890 WP_003898661.1.19900 WP_003898661.1.19922 WP_003898661.1.19936 WP_003898661.1.19946 WP_003898661.1.19949 WP_003898661.1.19960 WP_003898661.1.19964 WP_003898661.1.20007 WP_003898661.1.20016 WP_003898661.1.2003 WP_003898661.1.20037 WP_003898661.1.20039 WP_003898661.1.20082 WP_003898661.1.20085 WP_003898661.1.20097 WP_003898661.1.20116 WP_003898661.1.20130 WP_003898661.1.20141 WP_003898661.1.20142 WP_003898661.1.20158 WP_003898661.1.20239 WP_003898661.1.20243 WP_003898661.1.20259 WP_003898661.1.20262 WP_003898661.1.20272 WP_003898661.1.20273 WP_003898661.1.20280 WP_003898661.1.20294 WP_003898661.1.20300 WP_003898661.1.20309 WP_003898661.1.20322 WP_003898661.1.2037 WP_003898661.1.20372 WP_003898661.1.20381 WP_003898661.1.204 WP_003898661.1.20427 WP_003898661.1.20432 WP_003898661.1.20457 WP_003898661.1.20459 WP_003898661.1.20460 WP_003898661.1.20542 WP_003898661.1.20578 WP_003898661.1.20608 WP_003898661.1.20624 WP_003898661.1.20628 WP_003898661.1.2066 WP_003898661.1.20707 WP_003898661.1.20722 WP_003898661.1.20729 WP_003898661.1.20742 WP_003898661.1.20751 WP_003898661.1.20776 WP_003898661.1.20843 WP_003898661.1.20850 WP_003898661.1.2086 WP_003898661.1.20868 WP_003898661.1.20876 WP_003898661.1.20897 WP_003898661.1.20898 WP_003898661.1.2090 WP_003898661.1.20911 WP_003898661.1.20916 WP_003898661.1.20921 WP_003898661.1.20926 WP_003898661.1.20927 WP_003898661.1.20951 WP_003898661.1.20970 WP_003898661.1.2104 WP_003898661.1.21127 WP_003898661.1.21135 WP_003898661.1.21173 WP_003898661.1.21187 WP_003898661.1.212 WP_003898661.1.2120 WP_003898661.1.21218 WP_003898661.1.2123 WP_003898661.1.21231 WP_003898661.1.21234 WP_003898661.1.2126 WP_003898661.1.21292 WP_003898661.1.21307 WP_003898661.1.2131 WP_003898661.1.21311 WP_003898661.1.21321 WP_003898661.1.21365 WP_003898661.1.2137 WP_003898661.1.21392 WP_003898661.1.21397 WP_003898661.1.21403 WP_003898661.1.21415 WP_003898661.1.21418 WP_003898661.1.21430 WP_003898661.1.21434 WP_003898661.1.21444 WP_003898661.1.21468 WP_003898661.1.21498 WP_003898661.1.21509 WP_003898661.1.21513 WP_003898661.1.21560 WP_003898661.1.21565 WP_003898661.1.21586 WP_003898661.1.21591 WP_003898661.1.21594 WP_003898661.1.21602 WP_003898661.1.21615 WP_003898661.1.21638 WP_003898661.1.21639 WP_003898661.1.21655 WP_003898661.1.21658 WP_003898661.1.2168 WP_003898661.1.2174 WP_003898661.1.21741 WP_003898661.1.21742 WP_003898661.1.21777 WP_003898661.1.21786 WP_003898661.1.21795 WP_003898661.1.218 WP_003898661.1.21826 WP_003898661.1.21829 WP_003898661.1.21840 WP_003898661.1.21843 WP_003898661.1.21872 WP_003898661.1.21873 WP_003898661.1.2188 WP_003898661.1.21882 WP_003898661.1.21906 WP_003898661.1.21912 WP_003898661.1.2194 WP_003898661.1.21941 WP_003898661.1.21956 WP_003898661.1.21958 WP_003898661.1.21960 WP_003898661.1.21971 WP_003898661.1.21973 WP_003898661.1.21983 WP_003898661.1.22003 WP_003898661.1.22013 WP_003898661.1.22025 WP_003898661.1.22036 WP_003898661.1.22075 WP_003898661.1.22092 WP_003898661.1.2212 WP_003898661.1.22127 WP_003898661.1.22140 WP_003898661.1.22233 WP_003898661.1.22255 WP_003898661.1.22277 WP_003898661.1.22305 WP_003898661.1.22348 WP_003898661.1.22356 WP_003898661.1.22366 WP_003898661.1.2238 WP_003898661.1.22380 WP_003898661.1.22437 WP_003898661.1.22438 WP_003898661.1.22445 WP_003898661.1.22490 WP_003898661.1.22511 WP_003898661.1.22524 WP_003898661.1.2253 WP_003898661.1.22585 WP_003898661.1.22589 WP_003898661.1.22606 WP_003898661.1.22608 WP_003898661.1.22609 WP_003898661.1.22618 WP_003898661.1.2262 WP_003898661.1.22624 WP_003898661.1.22629 WP_003898661.1.22664 WP_003898661.1.22665 WP_003898661.1.22670 WP_003898661.1.22680 WP_003898661.1.22725 WP_003898661.1.22728 WP_003898661.1.22733 WP_003898661.1.22737 WP_003898661.1.2275 WP_003898661.1.22754 WP_003898661.1.22797 WP_003898661.1.22800 WP_003898661.1.22804 WP_003898661.1.22829 WP_003898661.1.22840 WP_003898661.1.22844 WP_003898661.1.22970 WP_003898661.1.22996 WP_003898661.1.22997 WP_003898661.1.22999 WP_003898661.1.23015 WP_003898661.1.23032 WP_003898661.1.231 WP_003898661.1.23101 WP_003898661.1.2312 WP_003898661.1.23140 WP_003898661.1.23153 WP_003898661.1.23171 WP_003898661.1.23199 WP_003898661.1.2320 WP_003898661.1.23204 WP_003898661.1.23216 WP_003898661.1.23229 WP_003898661.1.23233 WP_003898661.1.2326 WP_003898661.1.23261 WP_003898661.1.23272 WP_003898661.1.23289 WP_003898661.1.23308 WP_003898661.1.23316 WP_003898661.1.23321 WP_003898661.1.23325 WP_003898661.1.2339 WP_003898661.1.23406 WP_003898661.1.23438 WP_003898661.1.23445 WP_003898661.1.23447 WP_003898661.1.23452 WP_003898661.1.23461 WP_003898661.1.2349 WP_003898661.1.23496 WP_003898661.1.23497 WP_003898661.1.23506 WP_003898661.1.23530 WP_003898661.1.23539 WP_003898661.1.23546 WP_003898661.1.23551 WP_003898661.1.23573 WP_003898661.1.23583 WP_003898661.1.23588 WP_003898661.1.23628 WP_003898661.1.23677 WP_003898661.1.23683 WP_003898661.1.23692 WP_003898661.1.23694 WP_003898661.1.23699 WP_003898661.1.2371 WP_003898661.1.23803 WP_003898661.1.23807 WP_003898661.1.23825 WP_003898661.1.23832 WP_003898661.1.2384 WP_003898661.1.23843 WP_003898661.1.23863 WP_003898661.1.23894 WP_003898661.1.23993 WP_003898661.1.2400 WP_003898661.1.24007 WP_003898661.1.24008 WP_003898661.1.24046 WP_003898661.1.24057 WP_003898661.1.24062 WP_003898661.1.24113 WP_003898661.1.24119 WP_003898661.1.24128 WP_003898661.1.24140 WP_003898661.1.24176 WP_003898661.1.24190 WP_003898661.1.24202 WP_003898661.1.24244 WP_003898661.1.24261 WP_003898661.1.24284 WP_003898661.1.24294 WP_003898661.1.24357 WP_003898661.1.24396 WP_003898661.1.24423 WP_003898661.1.2443 WP_003898661.1.24446 WP_003898661.1.24461 WP_003898661.1.24500 WP_003898661.1.24507 WP_003898661.1.24509 WP_003898661.1.24529 WP_003898661.1.24553 WP_003898661.1.24629 WP_003898661.1.24638 WP_003898661.1.24648 WP_003898661.1.2466 WP_003898661.1.24767 WP_003898661.1.24824 WP_003898661.1.24831 WP_003898661.1.24840 WP_003898661.1.24848 WP_003898661.1.24857 WP_003898661.1.2487 WP_003898661.1.24893 WP_003898661.1.24907 WP_003898661.1.24933 WP_003898661.1.24956 WP_003898661.1.24958 WP_003898661.1.24985 WP_003898661.1.25004 WP_003898661.1.2505 WP_003898661.1.25051 WP_003898661.1.2507 WP_003898661.1.25096 WP_003898661.1.25103 WP_003898661.1.25129 WP_003898661.1.25171 WP_003898661.1.25184 WP_003898661.1.25247 WP_003898661.1.25252 WP_003898661.1.25278 WP_003898661.1.25309 WP_003898661.1.25313 WP_003898661.1.25338 WP_003898661.1.25342 WP_003898661.1.25343 WP_003898661.1.25367 WP_003898661.1.25393 WP_003898661.1.25406 WP_003898661.1.25435 WP_003898661.1.25437 WP_003898661.1.25445 WP_003898661.1.25455 WP_003898661.1.25473 WP_003898661.1.25513 WP_003898661.1.25542 WP_003898661.1.25579 WP_003898661.1.25594 WP_003898661.1.25606 WP_003898661.1.25645 WP_003898661.1.2566 WP_003898661.1.25673 WP_003898661.1.25674 WP_003898661.1.25693 WP_003898661.1.25699 WP_003898661.1.25727 WP_003898661.1.25736 WP_003898661.1.25738 WP_003898661.1.25759 WP_003898661.1.2580 WP_003898661.1.25813 WP_003898661.1.25853 WP_003898661.1.25854 WP_003898661.1.25874 WP_003898661.1.25892 WP_003898661.1.25906 WP_003898661.1.25914 WP_003898661.1.25916 WP_003898661.1.2594 WP_003898661.1.25954 WP_003898661.1.25965 WP_003898661.1.25972 WP_003898661.1.26017 WP_003898661.1.26032 WP_003898661.1.26038 WP_003898661.1.26072 WP_003898661.1.26089 WP_003898661.1.26097 WP_003898661.1.26098 WP_003898661.1.26108 WP_003898661.1.26109 WP_003898661.1.26118 WP_003898661.1.26126 WP_003898661.1.2614 WP_003898661.1.26168 WP_003898661.1.26190 WP_003898661.1.2620 WP_003898661.1.26243 WP_003898661.1.26265 WP_003898661.1.26267 WP_003898661.1.26292 WP_003898661.1.26310 WP_003898661.1.26328 WP_003898661.1.26349 WP_003898661.1.26366 WP_003898661.1.26374 WP_003898661.1.26407 WP_003898661.1.26412 WP_003898661.1.26454 WP_003898661.1.26464 WP_003898661.1.2653 WP_003898661.1.26560 WP_003898661.1.26571 WP_003898661.1.2659 WP_003898661.1.26597 WP_003898661.1.26603 WP_003898661.1.26629 WP_003898661.1.26651 WP_003898661.1.26702 WP_003898661.1.26707 WP_003898661.1.26710 WP_003898661.1.26737 WP_003898661.1.26738 WP_003898661.1.26745 WP_003898661.1.26756 WP_003898661.1.2676 WP_003898661.1.2677 WP_003898661.1.26779 WP_003898661.1.26780 WP_003898661.1.26798 WP_003898661.1.26854 WP_003898661.1.26876 WP_003898661.1.26888 WP_003898661.1.26914 WP_003898661.1.26945 WP_003898661.1.26959 WP_003898661.1.26969 WP_003898661.1.26984 WP_003898661.1.26992 WP_003898661.1.27004 WP_003898661.1.27017 WP_003898661.1.27045 WP_003898661.1.27074 WP_003898661.1.27075 WP_003898661.1.27128 WP_003898661.1.27139 WP_003898661.1.27152 WP_003898661.1.27162 WP_003898661.1.27164 WP_003898661.1.27193 WP_003898661.1.27254 WP_003898661.1.27278 WP_003898661.1.27343 WP_003898661.1.27352 WP_003898661.1.27369 WP_003898661.1.27391 WP_003898661.1.27398 WP_003898661.1.27402 WP_003898661.1.27410 WP_003898661.1.27411 WP_003898661.1.27449 WP_003898661.1.27460 WP_003898661.1.27463 WP_003898661.1.2749 WP_003898661.1.27492 WP_003898661.1.27528 WP_003898661.1.27541 WP_003898661.1.27576 WP_003898661.1.27582 WP_003898661.1.27596 WP_003898661.1.27607 WP_003898661.1.2766 WP_003898661.1.277 WP_003898661.1.27724 WP_003898661.1.27730 WP_003898661.1.27736 WP_003898661.1.27743 WP_003898661.1.27750 WP_003898661.1.27771 WP_003898661.1.27779 WP_003898661.1.27795 WP_003898661.1.27803 WP_003898661.1.27819 WP_003898661.1.27835 WP_003898661.1.27915 WP_003898661.1.27935 WP_003898661.1.28053 WP_003898661.1.28092 WP_003898661.1.28106 WP_003898661.1.28131 WP_003898661.1.28142 WP_003898661.1.28159 WP_003898661.1.2816 WP_003898661.1.28161 WP_003898661.1.28192 WP_003898661.1.28202 WP_003898661.1.28241 WP_003898661.1.28251 WP_003898661.1.28269 WP_003898661.1.28276 WP_003898661.1.28293 WP_003898661.1.28331 WP_003898661.1.28367 WP_003898661.1.28391 WP_003898661.1.2842 WP_003898661.1.28448 WP_003898661.1.2847 WP_003898661.1.28471 WP_003898661.1.28473 WP_003898661.1.28493 WP_003898661.1.28497 WP_003898661.1.28530 WP_003898661.1.28545 WP_003898661.1.28561 WP_003898661.1.28567 WP_003898661.1.28585 WP_003898661.1.286 WP_003898661.1.28610 WP_003898661.1.28617 WP_003898661.1.28634 WP_003898661.1.28642 WP_003898661.1.28671 WP_003898661.1.28682 WP_003898661.1.28698 WP_003898661.1.28703 WP_003898661.1.28739 WP_003898661.1.28758 WP_003898661.1.28781 WP_003898661.1.28787 WP_003898661.1.28827 WP_003898661.1.28839 WP_003898661.1.28847 WP_003898661.1.28850 WP_003898661.1.28851 WP_003898661.1.28865 WP_003898661.1.28897 WP_003898661.1.28914 WP_003898661.1.28935 WP_003898661.1.28936 WP_003898661.1.28939 WP_003898661.1.28943 WP_003898661.1.28952 WP_003898661.1.28975 WP_003898661.1.2899 WP_003898661.1.28993 WP_003898661.1.29000 WP_003898661.1.2901 WP_003898661.1.29028 WP_003898661.1.29033 WP_003898661.1.29058 WP_003898661.1.29078 WP_003898661.1.29102 WP_003898661.1.29115 WP_003898661.1.2916 WP_003898661.1.29217 WP_003898661.1.29223 WP_003898661.1.29234 WP_003898661.1.29264 WP_003898661.1.29275 WP_003898661.1.29306 WP_003898661.1.29339 WP_003898661.1.29348 WP_003898661.1.29364 WP_003898661.1.29367 WP_003898661.1.2938 WP_003898661.1.29399 WP_003898661.1.29426 WP_003898661.1.2944 WP_003898661.1.29449 WP_003898661.1.29450 WP_003898661.1.29452 WP_003898661.1.2949 WP_003898661.1.29510 WP_003898661.1.29515 WP_003898661.1.29525 WP_003898661.1.2953 WP_003898661.1.29559 WP_003898661.1.29587 WP_003898661.1.2959 WP_003898661.1.29592 WP_003898661.1.29599 WP_003898661.1.29611 WP_003898661.1.29632 WP_003898661.1.29649 WP_003898661.1.2965 WP_003898661.1.29659 WP_003898661.1.2969 WP_003898661.1.29696 WP_003898661.1.29698 WP_003898661.1.29718 WP_003898661.1.29742 WP_003898661.1.29745 WP_003898661.1.29747 WP_003898661.1.29769 WP_003898661.1.29830 WP_003898661.1.29847 WP_003898661.1.29861 WP_003898661.1.29869 WP_003898661.1.29883 WP_003898661.1.29890 WP_003898661.1.299 WP_003898661.1.29931 WP_003898661.1.29960 WP_003898661.1.30014 WP_003898661.1.3004 WP_003898661.1.30040 WP_003898661.1.30043 WP_003898661.1.30074 WP_003898661.1.30097 WP_003898661.1.30106 WP_003898661.1.30114 WP_003898661.1.30126 WP_003898661.1.30131 WP_003898661.1.30138 WP_003898661.1.30139 WP_003898661.1.30145 WP_003898661.1.30211 WP_003898661.1.30235 WP_003898661.1.30237 WP_003898661.1.3027 WP_003898661.1.30279 WP_003898661.1.30282 WP_003898661.1.30283 WP_003898661.1.30288 WP_003898661.1.30291 WP_003898661.1.30363 WP_003898661.1.30374 WP_003898661.1.30404 WP_003898661.1.3043 WP_003898661.1.30433 WP_003898661.1.30438 WP_003898661.1.30462 WP_003898661.1.30464 WP_003898661.1.30468 WP_003898661.1.30500 WP_003898661.1.3057 WP_003898661.1.30574 WP_003898661.1.30628 WP_003898661.1.30641 WP_003898661.1.30642 WP_003898661.1.30661 WP_003898661.1.30669 WP_003898661.1.30683 WP_003898661.1.30699 WP_003898661.1.30709 WP_003898661.1.30713 WP_003898661.1.30716 WP_003898661.1.30719 WP_003898661.1.30730 WP_003898661.1.30732 WP_003898661.1.30736 WP_003898661.1.30745 WP_003898661.1.30760 WP_003898661.1.30791 WP_003898661.1.308 WP_003898661.1.30807 WP_003898661.1.30818 WP_003898661.1.30824 WP_003898661.1.30848 WP_003898661.1.30877 WP_003898661.1.30888 WP_003898661.1.30901 WP_003898661.1.30903 WP_003898661.1.30912 WP_003898661.1.30913 WP_003898661.1.30914 WP_003898661.1.30919 WP_003898661.1.30977 WP_003898661.1.3100 WP_003898661.1.31002 WP_003898661.1.3101 WP_003898661.1.31047 WP_003898661.1.31074 WP_003898661.1.31102 WP_003898661.1.31127 WP_003898661.1.31199 WP_003898661.1.31230 WP_003898661.1.31233 WP_003898661.1.31263 WP_003898661.1.31264 WP_003898661.1.31270 WP_003898661.1.31287 WP_003898661.1.31290 WP_003898661.1.31304 WP_003898661.1.31346 WP_003898661.1.31348 WP_003898661.1.31354 WP_003898661.1.31390 WP_003898661.1.31414 WP_003898661.1.31417 WP_003898661.1.31428 WP_003898661.1.3143 WP_003898661.1.31458 WP_003898661.1.31483 WP_003898661.1.3149 WP_003898661.1.31498 WP_003898661.1.31507 WP_003898661.1.31537 WP_003898661.1.31548 WP_003898661.1.31569 WP_003898661.1.316 WP_003898661.1.31629 WP_003898661.1.31666 WP_003898661.1.31693 WP_003898661.1.31744 WP_003898661.1.31770 WP_003898661.1.31776 WP_003898661.1.31783 WP_003898661.1.318 WP_003898661.1.3184 WP_003898661.1.31840 WP_003898661.1.31880 WP_003898661.1.31911 WP_003898661.1.31930 WP_003898661.1.31932 WP_003898661.1.31955 WP_003898661.1.31985 WP_003898661.1.31991 WP_003898661.1.31995 WP_003898661.1.32004 WP_003898661.1.32039 WP_003898661.1.3204 WP_003898661.1.32045 WP_003898661.1.32071 WP_003898661.1.32098 WP_003898661.1.32132 WP_003898661.1.32157 WP_003898661.1.32164 WP_003898661.1.32179 WP_003898661.1.32198 WP_003898661.1.32297 WP_003898661.1.32317 WP_003898661.1.32383 WP_003898661.1.32400 WP_003898661.1.32403 WP_003898661.1.32416 WP_003898661.1.32421 WP_003898661.1.32433 WP_003898661.1.32461 WP_003898661.1.32482 WP_003898661.1.32503 WP_003898661.1.32556 WP_003898661.1.32562 WP_003898661.1.32569 WP_003898661.1.32592 WP_003898661.1.32620 WP_003898661.1.32647 WP_003898661.1.32653 WP_003898661.1.32654 WP_003898661.1.3268 WP_003898661.1.32695 WP_003898661.1.32706 WP_003898661.1.32716 WP_003898661.1.32738 WP_003898661.1.32752 WP_003898661.1.32780 WP_003898661.1.32781 WP_003898661.1.32793 WP_003898661.1.32799 WP_003898661.1.32822 WP_003898661.1.32833 WP_003898661.1.32880 WP_003898661.1.32897 WP_003898661.1.32909 WP_003898661.1.32935 WP_003898661.1.32974 WP_003898661.1.33007 WP_003898661.1.3302 WP_003898661.1.33028 WP_003898661.1.33035 WP_003898661.1.33044 WP_003898661.1.33054 WP_003898661.1.33082 WP_003898661.1.33141 WP_003898661.1.33148 WP_003898661.1.33155 WP_003898661.1.3321 WP_003898661.1.33215 WP_003898661.1.3325 WP_003898661.1.3327 WP_003898661.1.33278 WP_003898661.1.33288 WP_003898661.1.33305 WP_003898661.1.3331 WP_003898661.1.33319 WP_003898661.1.3333 WP_003898661.1.33393 WP_003898661.1.33403 WP_003898661.1.33452 WP_003898661.1.33467 WP_003898661.1.33477 WP_003898661.1.3349 WP_003898661.1.33542 WP_003898661.1.33601 WP_003898661.1.33602 WP_003898661.1.33633 WP_003898661.1.33646 WP_003898661.1.33673 WP_003898661.1.3369 WP_003898661.1.33705 WP_003898661.1.33762 WP_003898661.1.33783 WP_003898661.1.33789 WP_003898661.1.3383 WP_003898661.1.33832 WP_003898661.1.33839 WP_003898661.1.33848 WP_003898661.1.3387 WP_003898661.1.33895 WP_003898661.1.33912 WP_003898661.1.33954 WP_003898661.1.34042 WP_003898661.1.3405 WP_003898661.1.34055 WP_003898661.1.34056 WP_003898661.1.34065 WP_003898661.1.3408 WP_003898661.1.34090 WP_003898661.1.34109 WP_003898661.1.34111 WP_003898661.1.34131 WP_003898661.1.34152 WP_003898661.1.34163 WP_003898661.1.34181 WP_003898661.1.34197 WP_003898661.1.34198 WP_003898661.1.34215 WP_003898661.1.34219 WP_003898661.1.34255 WP_003898661.1.34260 WP_003898661.1.34275 WP_003898661.1.343 WP_003898661.1.34347 WP_003898661.1.34358 WP_003898661.1.34392 WP_003898661.1.344 WP_003898661.1.34428 WP_003898661.1.3443 WP_003898661.1.34435 WP_003898661.1.34499 WP_003898661.1.34505 WP_003898661.1.34516 WP_003898661.1.34529 WP_003898661.1.34551 WP_003898661.1.34563 WP_003898661.1.34576 WP_003898661.1.34581 WP_003898661.1.34588 WP_003898661.1.34596 WP_003898661.1.34599 WP_003898661.1.34639 WP_003898661.1.34673 WP_003898661.1.34724 WP_003898661.1.34740 WP_003898661.1.34755 WP_003898661.1.34777 WP_003898661.1.34783 WP_003898661.1.34841 WP_003898661.1.34908 WP_003898661.1.34919 WP_003898661.1.3492 WP_003898661.1.34933 WP_003898661.1.34945 WP_003898661.1.34946 WP_003898661.1.34954 WP_003898661.1.34960 WP_003898661.1.34961 WP_003898661.1.34963 WP_003898661.1.34965 WP_003898661.1.35023 WP_003898661.1.35069 WP_003898661.1.35072 WP_003898661.1.35078 WP_003898661.1.35100 WP_003898661.1.35156 WP_003898661.1.35160 WP_003898661.1.35162 WP_003898661.1.35173 WP_003898661.1.35176 WP_003898661.1.3520 WP_003898661.1.35213 WP_003898661.1.35221 WP_003898661.1.35246 WP_003898661.1.35278 WP_003898661.1.35301 WP_003898661.1.35312 WP_003898661.1.35317 WP_003898661.1.35319 WP_003898661.1.35347 WP_003898661.1.35363 WP_003898661.1.35382 WP_003898661.1.35385 WP_003898661.1.35396 WP_003898661.1.35397 WP_003898661.1.35426 WP_003898661.1.35439 WP_003898661.1.35455 WP_003898661.1.3548 WP_003898661.1.35484 WP_003898661.1.35492 WP_003898661.1.3553 WP_003898661.1.35553 WP_003898661.1.35555 WP_003898661.1.35561 WP_003898661.1.35602 WP_003898661.1.35610 WP_003898661.1.35635 WP_003898661.1.35657 WP_003898661.1.35687 WP_003898661.1.35689 WP_003898661.1.35707 WP_003898661.1.35732 WP_003898661.1.35754 WP_003898661.1.35767 WP_003898661.1.35770 WP_003898661.1.35771 WP_003898661.1.35780 WP_003898661.1.35805 WP_003898661.1.35811 WP_003898661.1.35821 WP_003898661.1.3584 WP_003898661.1.35848 WP_003898661.1.35864 WP_003898661.1.35874 WP_003898661.1.35876 WP_003898661.1.35897 WP_003898661.1.35899 WP_003898661.1.35923 WP_003898661.1.3593 WP_003898661.1.35954 WP_003898661.1.36005 WP_003898661.1.36014 WP_003898661.1.36023 WP_003898661.1.36051 WP_003898661.1.36053 WP_003898661.1.36075 WP_003898661.1.36089 WP_003898661.1.36097 WP_003898661.1.36098 WP_003898661.1.36116 WP_003898661.1.36145 WP_003898661.1.36205 WP_003898661.1.36228 WP_003898661.1.36246 WP_003898661.1.36252 WP_003898661.1.36260 WP_003898661.1.36270 WP_003898661.1.36271 WP_003898661.1.36303 WP_003898661.1.36309 WP_003898661.1.36315 WP_003898661.1.36319 WP_003898661.1.36321 WP_003898661.1.36326 WP_003898661.1.36356 WP_003898661.1.36357 WP_003898661.1.3636 WP_003898661.1.36385 WP_003898661.1.36399 WP_003898661.1.36436 WP_003898661.1.36465 WP_003898661.1.36469 WP_003898661.1.36473 WP_003898661.1.36485 WP_003898661.1.36508 WP_003898661.1.36540 WP_003898661.1.36561 WP_003898661.1.36571 WP_003898661.1.36573 WP_003898661.1.36578 WP_003898661.1.36585 WP_003898661.1.36597 WP_003898661.1.36614 WP_003898661.1.36657 WP_003898661.1.36674 WP_003898661.1.36720 WP_003898661.1.36727 WP_003898661.1.36733 WP_003898661.1.36810 WP_003898661.1.36844 WP_003898661.1.36851 WP_003898661.1.36862 WP_003898661.1.36893 WP_003898661.1.36901 WP_003898661.1.36921 WP_003898661.1.36935 WP_003898661.1.36941 WP_003898661.1.3695 WP_003898661.1.36968 WP_003898661.1.3700 WP_003898661.1.37004 WP_003898661.1.37012 WP_003898661.1.37071 WP_003898661.1.37088 WP_003898661.1.37131 WP_003898661.1.37157 WP_003898661.1.37175 WP_003898661.1.37188 WP_003898661.1.37213 WP_003898661.1.37229 WP_003898661.1.3724 WP_003898661.1.37277 WP_003898661.1.37305 WP_003898661.1.37330 WP_003898661.1.37389 WP_003898661.1.37400 WP_003898661.1.37440 WP_003898661.1.37459 WP_003898661.1.37468 WP_003898661.1.37475 WP_003898661.1.37484 WP_003898661.1.37601 WP_003898661.1.37612 WP_003898661.1.37632 WP_003898661.1.37643 WP_003898661.1.37655 WP_003898661.1.37660 WP_003898661.1.37674 WP_003898661.1.37700 WP_003898661.1.37701 WP_003898661.1.37709 WP_003898661.1.37711 WP_003898661.1.37721 WP_003898661.1.37722 WP_003898661.1.37747 WP_003898661.1.37765 WP_003898661.1.37772 WP_003898661.1.37804 WP_003898661.1.37809 WP_003898661.1.37877 WP_003898661.1.37912 WP_003898661.1.37913 WP_003898661.1.37943 WP_003898661.1.37950 WP_003898661.1.37973 WP_003898661.1.37975 WP_003898661.1.38 WP_003898661.1.38002 WP_003898661.1.3802 WP_003898661.1.38039 WP_003898661.1.38040 WP_003898661.1.38067 WP_003898661.1.38068 WP_003898661.1.38135 WP_003898661.1.38138 WP_003898661.1.38144 WP_003898661.1.38158 WP_003898661.1.38159 WP_003898661.1.38210 WP_003898661.1.38233 WP_003898661.1.38240 WP_003898661.1.38299 WP_003898661.1.38332 WP_003898661.1.38347 WP_003898661.1.38354 WP_003898661.1.38389 WP_003898661.1.38398 WP_003898661.1.38402 WP_003898661.1.38418 WP_003898661.1.38421 WP_003898661.1.38466 WP_003898661.1.38477 WP_003898661.1.38483 WP_003898661.1.3849 WP_003898661.1.385 WP_003898661.1.38530 WP_003898661.1.38535 WP_003898661.1.38539 WP_003898661.1.38594 WP_003898661.1.38611 WP_003898661.1.38638 WP_003898661.1.38639 WP_003898661.1.38646 WP_003898661.1.38648 WP_003898661.1.38654 WP_003898661.1.38660 WP_003898661.1.38666 WP_003898661.1.38671 WP_003898661.1.38672 WP_003898661.1.38677 WP_003898661.1.38750 WP_003898661.1.38772 WP_003898661.1.38812 WP_003898661.1.38821 WP_003898661.1.38844 WP_003898661.1.38863 WP_003898661.1.38865 WP_003898661.1.38873 WP_003898661.1.3889 WP_003898661.1.38894 WP_003898661.1.38909 WP_003898661.1.38939 WP_003898661.1.38974 WP_003898661.1.38975 WP_003898661.1.38991 WP_003898661.1.39025 WP_003898661.1.39070 WP_003898661.1.39072 WP_003898661.1.39095 WP_003898661.1.39106 WP_003898661.1.39165 WP_003898661.1.39174 WP_003898661.1.39176 WP_003898661.1.39178 WP_003898661.1.39190 WP_003898661.1.39201 WP_003898661.1.39207 WP_003898661.1.39211 WP_003898661.1.39236 WP_003898661.1.39239 WP_003898661.1.39252 WP_003898661.1.39288 WP_003898661.1.39295 WP_003898661.1.39306 WP_003898661.1.39359 WP_003898661.1.39364 WP_003898661.1.39400 WP_003898661.1.39447 WP_003898661.1.3945 WP_003898661.1.39450 WP_003898661.1.39455 WP_003898661.1.3949 WP_003898661.1.39521 WP_003898661.1.39560 WP_003898661.1.39592 WP_003898661.1.39593 WP_003898661.1.396 WP_003898661.1.3960 WP_003898661.1.39616 WP_003898661.1.39654 WP_003898661.1.39657 WP_003898661.1.39661 WP_003898661.1.39674 WP_003898661.1.39678 WP_003898661.1.3968 WP_003898661.1.39694 WP_003898661.1.3971 WP_003898661.1.39718 WP_003898661.1.39728 WP_003898661.1.39739 WP_003898661.1.39748 WP_003898661.1.39751 WP_003898661.1.39759 WP_003898661.1.39801 WP_003898661.1.39804 WP_003898661.1.39848 WP_003898661.1.39877 WP_003898661.1.39925 WP_003898661.1.3994 WP_003898661.1.39959 WP_003898661.1.3996 WP_003898661.1.39960 WP_003898661.1.3997 WP_003898661.1.39980 WP_003898661.1.40000 WP_003898661.1.40028 WP_003898661.1.40029 WP_003898661.1.4003 WP_003898661.1.40094 WP_003898661.1.40150 WP_003898661.1.40156 WP_003898661.1.40174 WP_003898661.1.40186 WP_003898661.1.40276 WP_003898661.1.40277 WP_003898661.1.40323 WP_003898661.1.40336 WP_003898661.1.40353 WP_003898661.1.4036 WP_003898661.1.40372 WP_003898661.1.40402 WP_003898661.1.40413 WP_003898661.1.40440 WP_003898661.1.40446 WP_003898661.1.40451 WP_003898661.1.40455 WP_003898661.1.40523 WP_003898661.1.40543 WP_003898661.1.40641 WP_003898661.1.40646 WP_003898661.1.40651 WP_003898661.1.40653 WP_003898661.1.4067 WP_003898661.1.40705 WP_003898661.1.40723 WP_003898661.1.40735 WP_003898661.1.40795 WP_003898661.1.40799 WP_003898661.1.40852 WP_003898661.1.40876 WP_003898661.1.40881 WP_003898661.1.40922 WP_003898661.1.4095 WP_003898661.1.40956 WP_003898661.1.40957 WP_003898661.1.40964 WP_003898661.1.4097 WP_003898661.1.410 WP_003898661.1.41000 WP_003898661.1.41055 WP_003898661.1.41108 WP_003898661.1.41123 WP_003898661.1.41202 WP_003898661.1.41219 WP_003898661.1.41231 WP_003898661.1.41249 WP_003898661.1.4127 WP_003898661.1.41355 WP_003898661.1.41376 WP_003898661.1.41430 WP_003898661.1.41447 WP_003898661.1.41469 WP_003898661.1.41504 WP_003898661.1.41564 WP_003898661.1.41583 WP_003898661.1.41616 WP_003898661.1.41632 WP_003898661.1.41635 WP_003898661.1.41636 WP_003898661.1.41648 WP_003898661.1.41660 WP_003898661.1.41685 WP_003898661.1.41695 WP_003898661.1.41704 WP_003898661.1.4171 WP_003898661.1.41719 WP_003898661.1.41733 WP_003898661.1.41744 WP_003898661.1.41774 WP_003898661.1.41791 WP_003898661.1.41820 WP_003898661.1.41828 WP_003898661.1.41829 WP_003898661.1.41860 WP_003898661.1.41912 WP_003898661.1.41921 WP_003898661.1.41933 WP_003898661.1.41944 WP_003898661.1.42043 WP_003898661.1.42075 WP_003898661.1.42078 WP_003898661.1.42094 WP_003898661.1.42112 WP_003898661.1.4212 WP_003898661.1.42122 WP_003898661.1.42134 WP_003898661.1.42183 WP_003898661.1.42188 WP_003898661.1.42201 WP_003898661.1.42202 WP_003898661.1.42208 WP_003898661.1.42247 WP_003898661.1.42255 WP_003898661.1.42273 WP_003898661.1.42278 WP_003898661.1.42304 WP_003898661.1.42309 WP_003898661.1.42370 WP_003898661.1.42385 WP_003898661.1.42400 WP_003898661.1.42409 WP_003898661.1.42414 WP_003898661.1.42417 WP_003898661.1.42430 WP_003898661.1.42461 WP_003898661.1.42465 WP_003898661.1.42467 WP_003898661.1.42473 WP_003898661.1.42474 WP_003898661.1.4248 WP_003898661.1.42494 WP_003898661.1.42519 WP_003898661.1.42524 WP_003898661.1.4255 WP_003898661.1.42562 WP_003898661.1.42568 WP_003898661.1.42570 WP_003898661.1.42618 WP_003898661.1.42660 WP_003898661.1.42695 WP_003898661.1.42704 WP_003898661.1.42705 WP_003898661.1.42722 WP_003898661.1.42777 WP_003898661.1.42782 WP_003898661.1.42835 WP_003898661.1.42839 WP_003898661.1.42842 WP_003898661.1.42905 WP_003898661.1.42916 WP_003898661.1.42930 WP_003898661.1.42971 WP_003898661.1.43005 WP_003898661.1.43009 WP_003898661.1.43053 WP_003898661.1.43082 WP_003898661.1.43087 WP_003898661.1.43098 WP_003898661.1.43208 WP_003898661.1.43236 WP_003898661.1.43246 WP_003898661.1.43255 WP_003898661.1.43266 WP_003898661.1.43269 WP_003898661.1.43273 WP_003898661.1.43296 WP_003898661.1.43306 WP_003898661.1.4335 WP_003898661.1.43368 WP_003898661.1.43395 WP_003898661.1.43457 WP_003898661.1.43462 WP_003898661.1.43475 WP_003898661.1.43478 WP_003898661.1.43484 WP_003898661.1.43557 WP_003898661.1.43578 WP_003898661.1.43588 WP_003898661.1.43643 WP_003898661.1.43664 WP_003898661.1.43684 WP_003898661.1.43686 WP_003898661.1.43706 WP_003898661.1.43716 WP_003898661.1.4377 WP_003898661.1.43781 WP_003898661.1.43794 WP_003898661.1.43815 WP_003898661.1.43846 WP_003898661.1.43861 WP_003898661.1.43863 WP_003898661.1.43866 WP_003898661.1.43872 WP_003898661.1.43885 WP_003898661.1.43897 WP_003898661.1.4390 WP_003898661.1.43902 WP_003898661.1.43921 WP_003898661.1.43937 WP_003898661.1.43960 WP_003898661.1.43965 WP_003898661.1.4399 WP_003898661.1.43993 WP_003898661.1.43996 WP_003898661.1.44 WP_003898661.1.44001 WP_003898661.1.44008 WP_003898661.1.44016 WP_003898661.1.44033 WP_003898661.1.44037 WP_003898661.1.44041 WP_003898661.1.44070 WP_003898661.1.44071 WP_003898661.1.44076 WP_003898661.1.44104 WP_003898661.1.44111 WP_003898661.1.44124 WP_003898661.1.44169 WP_003898661.1.44219 WP_003898661.1.44237 WP_003898661.1.44277 WP_003898661.1.44279 WP_003898661.1.44336 WP_003898661.1.44355 WP_003898661.1.44358 WP_003898661.1.4438 WP_003898661.1.44392 WP_003898661.1.4441 WP_003898661.1.44415 WP_003898661.1.44464 WP_003898661.1.44466 WP_003898661.1.44489 WP_003898661.1.44492 WP_003898661.1.44494 WP_003898661.1.44500 WP_003898661.1.44519 WP_003898661.1.44532 WP_003898661.1.44534 WP_003898661.1.44562 WP_003898661.1.44597 WP_003898661.1.44600 WP_003898661.1.44602 WP_003898661.1.44615 WP_003898661.1.4464 WP_003898661.1.44651 WP_003898661.1.44659 WP_003898661.1.44665 WP_003898661.1.44694 WP_003898661.1.44700 WP_003898661.1.44713 WP_003898661.1.44735 WP_003898661.1.44740 WP_003898661.1.4476 WP_003898661.1.44767 WP_003898661.1.44776 WP_003898661.1.44779 WP_003898661.1.44786 WP_003898661.1.44808 WP_003898661.1.44864 WP_003898661.1.44901 WP_003898661.1.44908 WP_003898661.1.44913 WP_003898661.1.4492 WP_003898661.1.44939 WP_003898661.1.44979 WP_003898661.1.44981 WP_003898661.1.45002 WP_003898661.1.45011 WP_003898661.1.4504 WP_003898661.1.45081 WP_003898661.1.45113 WP_003898661.1.45129 WP_003898661.1.45135 WP_003898661.1.45147 WP_003898661.1.45168 WP_003898661.1.4517 WP_003898661.1.45181 WP_003898661.1.45185 WP_003898661.1.45192 WP_003898661.1.45200 WP_003898661.1.45205 WP_003898661.1.45211 WP_003898661.1.45249 WP_003898661.1.4526 WP_003898661.1.45286 WP_003898661.1.45326 WP_003898661.1.45347 WP_003898661.1.45374 WP_003898661.1.45390 WP_003898661.1.454 WP_003898661.1.45407 WP_003898661.1.45451 WP_003898661.1.45453 WP_003898661.1.45460 WP_003898661.1.45463 WP_003898661.1.45470 WP_003898661.1.45474 WP_003898661.1.45491 WP_003898661.1.45510 WP_003898661.1.45563 WP_003898661.1.45584 WP_003898661.1.45590 WP_003898661.1.45619 WP_003898661.1.45626 WP_003898661.1.45631 WP_003898661.1.45666 WP_003898661.1.45697 WP_003898661.1.4571 WP_003898661.1.45731 WP_003898661.1.45743 WP_003898661.1.45765 WP_003898661.1.45776 WP_003898661.1.45805 WP_003898661.1.45815 WP_003898661.1.45849 WP_003898661.1.45867 WP_003898661.1.4590 WP_003898661.1.45923 WP_003898661.1.45926 WP_003898661.1.45963 WP_003898661.1.45989 WP_003898661.1.45992 WP_003898661.1.46025 WP_003898661.1.46083 WP_003898661.1.46090 WP_003898661.1.46092 WP_003898661.1.46100 WP_003898661.1.46101 WP_003898661.1.46103 WP_003898661.1.46107 WP_003898661.1.46127 WP_003898661.1.46128 WP_003898661.1.46129 WP_003898661.1.46141 WP_003898661.1.46150 WP_003898661.1.46201 WP_003898661.1.46226 WP_003898661.1.4624 WP_003898661.1.46253 WP_003898661.1.46268 WP_003898661.1.46285 WP_003898661.1.46300 WP_003898661.1.46313 WP_003898661.1.46336 WP_003898661.1.46365 WP_003898661.1.46370 WP_003898661.1.46381 WP_003898661.1.46411 WP_003898661.1.4644 WP_003898661.1.46442 WP_003898661.1.46453 WP_003898661.1.46463 WP_003898661.1.46478 WP_003898661.1.46492 WP_003898661.1.46521 WP_003898661.1.4653 WP_003898661.1.46532 WP_003898661.1.46539 WP_003898661.1.46568 WP_003898661.1.46585 WP_003898661.1.46609 WP_003898661.1.46613 WP_003898661.1.46625 WP_003898661.1.46642 WP_003898661.1.46647 WP_003898661.1.46674 WP_003898661.1.46724 WP_003898661.1.46773 WP_003898661.1.46777 WP_003898661.1.46786 WP_003898661.1.46792 WP_003898661.1.46847 WP_003898661.1.46851 WP_003898661.1.4687 WP_003898661.1.46897 WP_003898661.1.46936 WP_003898661.1.46980 WP_003898661.1.47011 WP_003898661.1.47066 WP_003898661.1.47077 WP_003898661.1.47083 WP_003898661.1.47106 WP_003898661.1.47142 WP_003898661.1.47147 WP_003898661.1.47166 WP_003898661.1.47178 WP_003898661.1.47179 WP_003898661.1.47194 WP_003898661.1.47207 WP_003898661.1.47210 WP_003898661.1.47261 WP_003898661.1.47262 WP_003898661.1.47402 WP_003898661.1.47467 WP_003898661.1.47502 WP_003898661.1.4751 WP_003898661.1.47511 WP_003898661.1.47537 WP_003898661.1.47540 WP_003898661.1.47568 WP_003898661.1.47572 WP_003898661.1.47588 WP_003898661.1.47636 WP_003898661.1.4764 WP_003898661.1.47653 WP_003898661.1.47679 WP_003898661.1.47681 WP_003898661.1.47690 WP_003898661.1.4771 WP_003898661.1.47717 WP_003898661.1.47743 WP_003898661.1.47754 WP_003898661.1.47773 WP_003898661.1.47776 WP_003898661.1.47805 WP_003898661.1.47832 WP_003898661.1.47847 WP_003898661.1.47858 WP_003898661.1.47861 WP_003898661.1.47868 WP_003898661.1.47893 WP_003898661.1.47899 WP_003898661.1.479 WP_003898661.1.47912 WP_003898661.1.47913 WP_003898661.1.47926 WP_003898661.1.4794 WP_003898661.1.47944 WP_003898661.1.47959 WP_003898661.1.47974 WP_003898661.1.47993 WP_003898661.1.48004 WP_003898661.1.48039 WP_003898661.1.48050 WP_003898661.1.48084 WP_003898661.1.48097 WP_003898661.1.48101 WP_003898661.1.48109 WP_003898661.1.4813 WP_003898661.1.48130 WP_003898661.1.48135 WP_003898661.1.48143 WP_003898661.1.48152 WP_003898661.1.48155 WP_003898661.1.48170 WP_003898661.1.48173 WP_003898661.1.48177 WP_003898661.1.48185 WP_003898661.1.48219 WP_003898661.1.4823 WP_003898661.1.48240 WP_003898661.1.48256 WP_003898661.1.48264 WP_003898661.1.48287 WP_003898661.1.48330 WP_003898661.1.48333 WP_003898661.1.48348 WP_003898661.1.48354 WP_003898661.1.48372 WP_003898661.1.48383 WP_003898661.1.48388 WP_003898661.1.48419 WP_003898661.1.48423 WP_003898661.1.48443 WP_003898661.1.48462 WP_003898661.1.48543 WP_003898661.1.48550 WP_003898661.1.48605 WP_003898661.1.4863 WP_003898661.1.48648 WP_003898661.1.48658 WP_003898661.1.48666 WP_003898661.1.48687 WP_003898661.1.48779 WP_003898661.1.4878 WP_003898661.1.48798 WP_003898661.1.48802 WP_003898661.1.48826 WP_003898661.1.48831 WP_003898661.1.48843 WP_003898661.1.48857 WP_003898661.1.4890 WP_003898661.1.48946 WP_003898661.1.48979 WP_003898661.1.49017 WP_003898661.1.49048 WP_003898661.1.49059 WP_003898661.1.4906 WP_003898661.1.4907 WP_003898661.1.49103 WP_003898661.1.49110 WP_003898661.1.49111 WP_003898661.1.49112 WP_003898661.1.4919 WP_003898661.1.49251 WP_003898661.1.49254 WP_003898661.1.49263 WP_003898661.1.49291 WP_003898661.1.49296 WP_003898661.1.49335 WP_003898661.1.49337 WP_003898661.1.49419 WP_003898661.1.49426 WP_003898661.1.49437 WP_003898661.1.49439 WP_003898661.1.49474 WP_003898661.1.49506 WP_003898661.1.49516 WP_003898661.1.49523 WP_003898661.1.49526 WP_003898661.1.49532 WP_003898661.1.4959 WP_003898661.1.49678 WP_003898661.1.49687 WP_003898661.1.49699 WP_003898661.1.49709 WP_003898661.1.4972 WP_003898661.1.49736 WP_003898661.1.49746 WP_003898661.1.49764 WP_003898661.1.49773 WP_003898661.1.49796 WP_003898661.1.49814 WP_003898661.1.49815 WP_003898661.1.49816 WP_003898661.1.49839 WP_003898661.1.49857 WP_003898661.1.49878 WP_003898661.1.49880 WP_003898661.1.49944 WP_003898661.1.4999 WP_003898661.1.49990 WP_003898661.1.50068 WP_003898661.1.50077 WP_003898661.1.5008 WP_003898661.1.50081 WP_003898661.1.50122 WP_003898661.1.50126 WP_003898661.1.50149 WP_003898661.1.5018 WP_003898661.1.50194 WP_003898661.1.50218 WP_003898661.1.50235 WP_003898661.1.50249 WP_003898661.1.50265 WP_003898661.1.50271 WP_003898661.1.50324 WP_003898661.1.50347 WP_003898661.1.50372 WP_003898661.1.50398 WP_003898661.1.50407 WP_003898661.1.50444 WP_003898661.1.50466 WP_003898661.1.50472 WP_003898661.1.5048 WP_003898661.1.50498 WP_003898661.1.5050 WP_003898661.1.50540 WP_003898661.1.50554 WP_003898661.1.50557 WP_003898661.1.50601 WP_003898661.1.50610 WP_003898661.1.50632 WP_003898661.1.50633 WP_003898661.1.50642 WP_003898661.1.50655 WP_003898661.1.50659 WP_003898661.1.50683 WP_003898661.1.50689 WP_003898661.1.50692 WP_003898661.1.50714 WP_003898661.1.50729 WP_003898661.1.50756 WP_003898661.1.50784 WP_003898661.1.50794 WP_003898661.1.50841 WP_003898661.1.50860 WP_003898661.1.50877 WP_003898661.1.5096 WP_003898661.1.50981 WP_003898661.1.50987 WP_003898661.1.51003 WP_003898661.1.51009 WP_003898661.1.51037 WP_003898661.1.51074 WP_003898661.1.51082 WP_003898661.1.51101 WP_003898661.1.51116 WP_003898661.1.51149 WP_003898661.1.51156 WP_003898661.1.51157 WP_003898661.1.51232 WP_003898661.1.51239 WP_003898661.1.51247 WP_003898661.1.51266 WP_003898661.1.51279 WP_003898661.1.51291 WP_003898661.1.51294 WP_003898661.1.51301 WP_003898661.1.51329 WP_003898661.1.51391 WP_003898661.1.51422 WP_003898661.1.51445 WP_003898661.1.51455 WP_003898661.1.51466 WP_003898661.1.51468 WP_003898661.1.51478 WP_003898661.1.51497 WP_003898661.1.51520 WP_003898661.1.51593 WP_003898661.1.51628 WP_003898661.1.5164 WP_003898661.1.51647 WP_003898661.1.51660 WP_003898661.1.51696 WP_003898661.1.51788 WP_003898661.1.51795 WP_003898661.1.51801 WP_003898661.1.51817 WP_003898661.1.51819 WP_003898661.1.51854 WP_003898661.1.51923 WP_003898661.1.51942 WP_003898661.1.51948 WP_003898661.1.51963 WP_003898661.1.51969 WP_003898661.1.52000 WP_003898661.1.52001 WP_003898661.1.52003 WP_003898661.1.52006 WP_003898661.1.52036 WP_003898661.1.52046 WP_003898661.1.52059 WP_003898661.1.52069 WP_003898661.1.52082 WP_003898661.1.52102 WP_003898661.1.52106 WP_003898661.1.52166 WP_003898661.1.52168 WP_003898661.1.52173 WP_003898661.1.52178 WP_003898661.1.52206 WP_003898661.1.52216 WP_003898661.1.52238 WP_003898661.1.52241 WP_003898661.1.52280 WP_003898661.1.52314 WP_003898661.1.52385 WP_003898661.1.52390 WP_003898661.1.524 WP_003898661.1.52460 WP_003898661.1.52485 WP_003898661.1.52486 WP_003898661.1.52495 WP_003898661.1.52504 WP_003898661.1.52522 WP_003898661.1.52531 WP_003898661.1.52533 WP_003898661.1.52545 WP_003898661.1.52553 WP_003898661.1.52563 WP_003898661.1.52564 WP_003898661.1.52574 WP_003898661.1.52641 WP_003898661.1.52673 WP_003898661.1.52674 WP_003898661.1.52708 WP_003898661.1.52713 WP_003898661.1.52761 WP_003898661.1.52778 WP_003898661.1.52797 WP_003898661.1.52818 WP_003898661.1.52873 WP_003898661.1.52891 WP_003898661.1.52892 WP_003898661.1.52909 WP_003898661.1.52970 WP_003898661.1.52998 WP_003898661.1.53053 WP_003898661.1.53056 WP_003898661.1.5306 WP_003898661.1.53088 WP_003898661.1.5309 WP_003898661.1.531 WP_003898661.1.53118 WP_003898661.1.53142 WP_003898661.1.53143 WP_003898661.1.53157 WP_003898661.1.53167 WP_003898661.1.53200 WP_003898661.1.53204 WP_003898661.1.53213 WP_003898661.1.53229 WP_003898661.1.53230 WP_003898661.1.53237 WP_003898661.1.53254 WP_003898661.1.53257 WP_003898661.1.5327 WP_003898661.1.53276 WP_003898661.1.53278 WP_003898661.1.533 WP_003898661.1.53306 WP_003898661.1.5334 WP_003898661.1.5335 WP_003898661.1.53353 WP_003898661.1.53381 WP_003898661.1.53413 WP_003898661.1.53458 WP_003898661.1.53460 WP_003898661.1.53480 WP_003898661.1.53517 WP_003898661.1.53522 WP_003898661.1.53525 WP_003898661.1.53526 WP_003898661.1.53553 WP_003898661.1.53606 WP_003898661.1.53609 WP_003898661.1.53628 WP_003898661.1.53643 WP_003898661.1.53667 WP_003898661.1.53679 WP_003898661.1.53715 WP_003898661.1.53730 WP_003898661.1.53742 WP_003898661.1.53743 WP_003898661.1.53754 WP_003898661.1.53775 WP_003898661.1.53787 WP_003898661.1.53803 WP_003898661.1.53818 WP_003898661.1.53822 WP_003898661.1.53853 WP_003898661.1.53865 WP_003898661.1.53888 WP_003898661.1.53900 WP_003898661.1.53912 WP_003898661.1.53914 WP_003898661.1.53952 WP_003898661.1.5398 WP_003898661.1.5408 WP_003898661.1.54089 WP_003898661.1.54093 WP_003898661.1.54099 WP_003898661.1.54112 WP_003898661.1.54125 WP_003898661.1.54141 WP_003898661.1.54162 WP_003898661.1.54179 WP_003898661.1.54206 WP_003898661.1.54218 WP_003898661.1.54225 WP_003898661.1.54227 WP_003898661.1.54232 WP_003898661.1.54241 WP_003898661.1.54245 WP_003898661.1.54260 WP_003898661.1.54275 WP_003898661.1.54280 WP_003898661.1.5429 WP_003898661.1.54294 WP_003898661.1.54314 WP_003898661.1.54347 WP_003898661.1.54351 WP_003898661.1.54370 WP_003898661.1.54428 WP_003898661.1.54449 WP_003898661.1.54494 WP_003898661.1.54502 WP_003898661.1.54514 WP_003898661.1.54519 WP_003898661.1.5452 WP_003898661.1.54531 WP_003898661.1.54537 WP_003898661.1.54553 WP_003898661.1.54555 WP_003898661.1.54575 WP_003898661.1.54633 WP_003898661.1.54686 WP_003898661.1.54687 WP_003898661.1.54705 WP_003898661.1.54730 WP_003898661.1.54732 WP_003898661.1.5475 WP_003898661.1.54797 WP_003898661.1.54807 WP_003898661.1.54836 WP_003898661.1.54838 WP_003898661.1.54860 WP_003898661.1.54888 WP_003898661.1.54897 WP_003898661.1.54905 WP_003898661.1.54909 WP_003898661.1.54937 WP_003898661.1.54939 WP_003898661.1.54944 WP_003898661.1.54945 WP_003898661.1.54953 WP_003898661.1.54964 WP_003898661.1.55015 WP_003898661.1.55022 WP_003898661.1.55023 WP_003898661.1.55051 WP_003898661.1.55072 WP_003898661.1.55088 WP_003898661.1.55106 WP_003898661.1.55126 WP_003898661.1.55128 WP_003898661.1.55140 WP_003898661.1.55210 WP_003898661.1.55227 WP_003898661.1.55248 WP_003898661.1.55257 WP_003898661.1.55258 WP_003898661.1.55267 WP_003898661.1.55279 WP_003898661.1.55307 WP_003898661.1.55326 WP_003898661.1.55328 WP_003898661.1.5533 WP_003898661.1.55345 WP_003898661.1.55396 WP_003898661.1.55398 WP_003898661.1.55441 WP_003898661.1.55459 WP_003898661.1.55501 WP_003898661.1.55578 WP_003898661.1.55626 WP_003898661.1.55641 WP_003898661.1.5569 WP_003898661.1.55723 WP_003898661.1.55735 WP_003898661.1.5574 WP_003898661.1.55772 WP_003898661.1.55802 WP_003898661.1.55807 WP_003898661.1.55819 WP_003898661.1.5583 WP_003898661.1.55849 WP_003898661.1.55856 WP_003898661.1.55860 WP_003898661.1.55882 WP_003898661.1.55883 WP_003898661.1.55894 WP_003898661.1.55902 WP_003898661.1.55908 WP_003898661.1.55909 WP_003898661.1.5591 WP_003898661.1.55961 WP_003898661.1.55977 WP_003898661.1.55983 WP_003898661.1.56028 WP_003898661.1.56057 WP_003898661.1.56060 WP_003898661.1.56107 WP_003898661.1.56132 WP_003898661.1.56163 WP_003898661.1.56167 WP_003898661.1.56178 WP_003898661.1.56287 WP_003898661.1.56292 WP_003898661.1.56327 WP_003898661.1.56341 WP_003898661.1.56359 WP_003898661.1.56365 WP_003898661.1.56394 WP_003898661.1.56443 WP_003898661.1.56473 WP_003898661.1.56478 WP_003898661.1.56500 WP_003898661.1.56517 WP_003898661.1.56534 WP_003898661.1.5656 WP_003898661.1.56577 WP_003898661.1.56593 WP_003898661.1.56625 WP_003898661.1.56637 WP_003898661.1.56670 WP_003898661.1.56697 WP_003898661.1.567 WP_003898661.1.56701 WP_003898661.1.56709 WP_003898661.1.56729 WP_003898661.1.56743 WP_003898661.1.56755 WP_003898661.1.56764 WP_003898661.1.56769 WP_003898661.1.56770 WP_003898661.1.56795 WP_003898661.1.5681 WP_003898661.1.56827 WP_003898661.1.56839 WP_003898661.1.56863 WP_003898661.1.56868 WP_003898661.1.56869 WP_003898661.1.56926 WP_003898661.1.56961 WP_003898661.1.56971 WP_003898661.1.56972 WP_003898661.1.57023 WP_003898661.1.57077 WP_003898661.1.57087 WP_003898661.1.57094 WP_003898661.1.57134 WP_003898661.1.57169 WP_003898661.1.57208 WP_003898661.1.57212 WP_003898661.1.57230 WP_003898661.1.5724 WP_003898661.1.5725 WP_003898661.1.5727 WP_003898661.1.57273 WP_003898661.1.573 WP_003898661.1.57314 WP_003898661.1.57326 WP_003898661.1.57328 WP_003898661.1.57331 WP_003898661.1.57340 WP_003898661.1.57351 WP_003898661.1.57352 WP_003898661.1.57380 WP_003898661.1.57430 WP_003898661.1.5744 WP_003898661.1.57440 WP_003898661.1.5745 WP_003898661.1.57461 WP_003898661.1.57469 WP_003898661.1.57489 WP_003898661.1.575 WP_003898661.1.57519 WP_003898661.1.57525 WP_003898661.1.57551 WP_003898661.1.5758 WP_003898661.1.57596 WP_003898661.1.57604 WP_003898661.1.57616 WP_003898661.1.57619 WP_003898661.1.57627 WP_003898661.1.57642 WP_003898661.1.57658 WP_003898661.1.57667 WP_003898661.1.57675 WP_003898661.1.57689 WP_003898661.1.57708 WP_003898661.1.57794 WP_003898661.1.57821 WP_003898661.1.57825 WP_003898661.1.57843 WP_003898661.1.57906 WP_003898661.1.57924 WP_003898661.1.57926 WP_003898661.1.57957 WP_003898661.1.57960 WP_003898661.1.57964 WP_003898661.1.57991 WP_003898661.1.58000 WP_003898661.1.58086 WP_003898661.1.58101 WP_003898661.1.58103 WP_003898661.1.58108 WP_003898661.1.5811 WP_003898661.1.58121 WP_003898661.1.58145 WP_003898661.1.58164 WP_003898661.1.58174 WP_003898661.1.582 WP_003898661.1.58209 WP_003898661.1.58215 WP_003898661.1.5824 WP_003898661.1.58250 WP_003898661.1.58259 WP_003898661.1.58283 WP_003898661.1.58288 WP_003898661.1.5830 WP_003898661.1.58303 WP_003898661.1.58311 WP_003898661.1.58330 WP_003898661.1.58359 WP_003898661.1.58386 WP_003898661.1.58393 WP_003898661.1.58431 WP_003898661.1.5844 WP_003898661.1.58457 WP_003898661.1.58488 WP_003898661.1.58518 WP_003898661.1.58534 WP_003898661.1.58559 WP_003898661.1.58567 WP_003898661.1.58573 WP_003898661.1.58602 WP_003898661.1.58612 WP_003898661.1.58619 WP_003898661.1.58630 WP_003898661.1.5865 WP_003898661.1.58671 WP_003898661.1.58690 WP_003898661.1.58702 WP_003898661.1.58743 WP_003898661.1.58754 WP_003898661.1.5879 WP_003898661.1.5881 WP_003898661.1.58848 WP_003898661.1.58857 WP_003898661.1.58891 WP_003898661.1.58892 WP_003898661.1.5890 WP_003898661.1.58921 WP_003898661.1.58930 WP_003898661.1.58941 WP_003898661.1.58953 WP_003898661.1.58961 WP_003898661.1.5898 WP_003898661.1.59025 WP_003898661.1.59029 WP_003898661.1.59037 WP_003898661.1.59085 WP_003898661.1.59088 WP_003898661.1.59112 WP_003898661.1.59130 WP_003898661.1.5914 WP_003898661.1.59147 WP_003898661.1.59166 WP_003898661.1.59205 WP_003898661.1.59209 WP_003898661.1.59237 WP_003898661.1.59240 WP_003898661.1.59253 WP_003898661.1.59254 WP_003898661.1.59262 WP_003898661.1.59270 WP_003898661.1.5928 WP_003898661.1.59304 WP_003898661.1.59305 WP_003898661.1.59309 WP_003898661.1.59316 WP_003898661.1.59326 WP_003898661.1.59333 WP_003898661.1.59388 WP_003898661.1.59487 WP_003898661.1.59537 WP_003898661.1.59561 WP_003898661.1.59677 WP_003898661.1.59722 WP_003898661.1.59727 WP_003898661.1.59732 WP_003898661.1.59738 WP_003898661.1.59750 WP_003898661.1.59757 WP_003898661.1.59761 WP_003898661.1.59808 WP_003898661.1.59850 WP_003898661.1.59860 WP_003898661.1.59861 WP_003898661.1.5987 WP_003898661.1.59878 WP_003898661.1.59888 WP_003898661.1.59952 WP_003898661.1.5996 WP_003898661.1.59961 WP_003898661.1.59974 WP_003898661.1.6000 WP_003898661.1.60016 WP_003898661.1.6003 WP_003898661.1.60047 WP_003898661.1.6007 WP_003898661.1.60121 WP_003898661.1.60125 WP_003898661.1.60135 WP_003898661.1.60139 WP_003898661.1.60152 WP_003898661.1.60171 WP_003898661.1.60197 WP_003898661.1.6020 WP_003898661.1.60205 WP_003898661.1.60207 WP_003898661.1.60215 WP_003898661.1.60217 WP_003898661.1.60267 WP_003898661.1.60288 WP_003898661.1.60301 WP_003898661.1.60305 WP_003898661.1.60312 WP_003898661.1.60313 WP_003898661.1.60314 WP_003898661.1.60367 WP_003898661.1.60376 WP_003898661.1.60403 WP_003898661.1.60413 WP_003898661.1.60421 WP_003898661.1.60451 WP_003898661.1.60460 WP_003898661.1.60487 WP_003898661.1.60512 WP_003898661.1.60573 WP_003898661.1.60583 WP_003898661.1.60632 WP_003898661.1.60657 WP_003898661.1.60687 WP_003898661.1.60689 WP_003898661.1.60727 WP_003898661.1.60763 WP_003898661.1.6077 WP_003898661.1.60791 WP_003898661.1.60834 WP_003898661.1.60870 WP_003898661.1.60878 WP_003898661.1.60879 WP_003898661.1.60913 WP_003898661.1.60978 WP_003898661.1.61000 WP_003898661.1.61012 WP_003898661.1.61014 WP_003898661.1.61015 WP_003898661.1.61037 WP_003898661.1.61065 WP_003898661.1.61100 WP_003898661.1.61101 WP_003898661.1.61138 WP_003898661.1.61142 WP_003898661.1.61198 WP_003898661.1.612 WP_003898661.1.61234 WP_003898661.1.61256 WP_003898661.1.61281 WP_003898661.1.61314 WP_003898661.1.61321 WP_003898661.1.61326 WP_003898661.1.61328 WP_003898661.1.61368 WP_003898661.1.61391 WP_003898661.1.61406 WP_003898661.1.61409 WP_003898661.1.61420 WP_003898661.1.61422 WP_003898661.1.61425 WP_003898661.1.61428 WP_003898661.1.61469 WP_003898661.1.61494 WP_003898661.1.61522 WP_003898661.1.61552 WP_003898661.1.61557 WP_003898661.1.61567 WP_003898661.1.61571 WP_003898661.1.61573 WP_003898661.1.61584 WP_003898661.1.61586 WP_003898661.1.6159 WP_003898661.1.61592 WP_003898661.1.6160 WP_003898661.1.61614 WP_003898661.1.6163 WP_003898661.1.61655 WP_003898661.1.61665 WP_003898661.1.61669 WP_003898661.1.61682 WP_003898661.1.61692 WP_003898661.1.61719 WP_003898661.1.61728 WP_003898661.1.61754 WP_003898661.1.61755 WP_003898661.1.61757 WP_003898661.1.61778 WP_003898661.1.6179 WP_003898661.1.61793 WP_003898661.1.61816 WP_003898661.1.61842 WP_003898661.1.61850 WP_003898661.1.61862 WP_003898661.1.61865 WP_003898661.1.61868 WP_003898661.1.61911 WP_003898661.1.61925 WP_003898661.1.61941 WP_003898661.1.61953 WP_003898661.1.61979 WP_003898661.1.61986 WP_003898661.1.61987 WP_003898661.1.61998 WP_003898661.1.62021 WP_003898661.1.62087 WP_003898661.1.62089 WP_003898661.1.62101 WP_003898661.1.62104 WP_003898661.1.6211 WP_003898661.1.62132 WP_003898661.1.62162 WP_003898661.1.62225 WP_003898661.1.62230 WP_003898661.1.62238 WP_003898661.1.62249 WP_003898661.1.62270 WP_003898661.1.62281 WP_003898661.1.62307 WP_003898661.1.6231 WP_003898661.1.62359 WP_003898661.1.62360 WP_003898661.1.62371 WP_003898661.1.62379 WP_003898661.1.62395 WP_003898661.1.62449 WP_003898661.1.62468 WP_003898661.1.6248 WP_003898661.1.62508 WP_003898661.1.62565 WP_003898661.1.62594 WP_003898661.1.62606 WP_003898661.1.62666 WP_003898661.1.62687 WP_003898661.1.62715 WP_003898661.1.62738 WP_003898661.1.62761 WP_003898661.1.62766 WP_003898661.1.62813 WP_003898661.1.62839 WP_003898661.1.62841 WP_003898661.1.62909 WP_003898661.1.62936 WP_003898661.1.6294 WP_003898661.1.6295 WP_003898661.1.62962 WP_003898661.1.63007 WP_003898661.1.63019 WP_003898661.1.63032 WP_003898661.1.63037 WP_003898661.1.63064 WP_003898661.1.63066 WP_003898661.1.63072 WP_003898661.1.6308 WP_003898661.1.63081 WP_003898661.1.63096 WP_003898661.1.63106 WP_003898661.1.6314 WP_003898661.1.63144 WP_003898661.1.63154 WP_003898661.1.63160 WP_003898661.1.63161 WP_003898661.1.63166 WP_003898661.1.63175 WP_003898661.1.63194 WP_003898661.1.63222 WP_003898661.1.63247 WP_003898661.1.6328 WP_003898661.1.63291 WP_003898661.1.63312 WP_003898661.1.63317 WP_003898661.1.63331 WP_003898661.1.63373 WP_003898661.1.63384 WP_003898661.1.63403 WP_003898661.1.63424 WP_003898661.1.63428 WP_003898661.1.6345 WP_003898661.1.63464 WP_003898661.1.63483 WP_003898661.1.63502 WP_003898661.1.63504 WP_003898661.1.63522 WP_003898661.1.63530 WP_003898661.1.63538 WP_003898661.1.63564 WP_003898661.1.63567 WP_003898661.1.63596 WP_003898661.1.63600 WP_003898661.1.63623 WP_003898661.1.63624 WP_003898661.1.63625 WP_003898661.1.63627 WP_003898661.1.63654 WP_003898661.1.63662 WP_003898661.1.63711 WP_003898661.1.63734 WP_003898661.1.63807 WP_003898661.1.63819 WP_003898661.1.63844 WP_003898661.1.63888 WP_003898661.1.63913 WP_003898661.1.63915 WP_003898661.1.63918 WP_003898661.1.63961 WP_003898661.1.63970 WP_003898661.1.64000 WP_003898661.1.64027 WP_003898661.1.64058 WP_003898661.1.64065 WP_003898661.1.6407 WP_003898661.1.64082 WP_003898661.1.64091 WP_003898661.1.64102 WP_003898661.1.64104 WP_003898661.1.64169 WP_003898661.1.64219 WP_003898661.1.6422 WP_003898661.1.64222 WP_003898661.1.64223 WP_003898661.1.64228 WP_003898661.1.64235 WP_003898661.1.64249 WP_003898661.1.6427 WP_003898661.1.64278 WP_003898661.1.64287 WP_003898661.1.64414 WP_003898661.1.64419 WP_003898661.1.6443 WP_003898661.1.64480 WP_003898661.1.64497 WP_003898661.1.64506 WP_003898661.1.64511 WP_003898661.1.64513 WP_003898661.1.64514 WP_003898661.1.64515 WP_003898661.1.64522 WP_003898661.1.64526 WP_003898661.1.64543 WP_003898661.1.6456 WP_003898661.1.64567 WP_003898661.1.64588 WP_003898661.1.64589 WP_003898661.1.64595 WP_003898661.1.64608 WP_003898661.1.64619 WP_003898661.1.64629 WP_003898661.1.6464 WP_003898661.1.64664 WP_003898661.1.64669 WP_003898661.1.64672 WP_003898661.1.64680 WP_003898661.1.64682 WP_003898661.1.64727 WP_003898661.1.64729 WP_003898661.1.64774 WP_003898661.1.64776 WP_003898661.1.64832 WP_003898661.1.6486 WP_003898661.1.64898 WP_003898661.1.64922 WP_003898661.1.64924 WP_003898661.1.6493 WP_003898661.1.64941 WP_003898661.1.64966 WP_003898661.1.64973 WP_003898661.1.65001 WP_003898661.1.65026 WP_003898661.1.65053 WP_003898661.1.65070 WP_003898661.1.65079 WP_003898661.1.65102 WP_003898661.1.65157 WP_003898661.1.65181 WP_003898661.1.65212 WP_003898661.1.65229 WP_003898661.1.6523 WP_003898661.1.65253 WP_003898661.1.65289 WP_003898661.1.65291 WP_003898661.1.65315 WP_003898661.1.65329 WP_003898661.1.65359 WP_003898661.1.6536 WP_003898661.1.65374 WP_003898661.1.65414 WP_003898661.1.65416 WP_003898661.1.65433 WP_003898661.1.65455 WP_003898661.1.65467 WP_003898661.1.65529 WP_003898661.1.65539 WP_003898661.1.65583 WP_003898661.1.65612 WP_003898661.1.65623 WP_003898661.1.65635 WP_003898661.1.65637 WP_003898661.1.65683 WP_003898661.1.65686 WP_003898661.1.65688 WP_003898661.1.65707 WP_003898661.1.65733 WP_003898661.1.65746 WP_003898661.1.65747 WP_003898661.1.65759 WP_003898661.1.65816 WP_003898661.1.65830 WP_003898661.1.65858 WP_003898661.1.65862 WP_003898661.1.65869 WP_003898661.1.65893 WP_003898661.1.65929 WP_003898661.1.65932 WP_003898661.1.65958 WP_003898661.1.65974 WP_003898661.1.66004 WP_003898661.1.66013 WP_003898661.1.6606 WP_003898661.1.66089 WP_003898661.1.66149 WP_003898661.1.66151 WP_003898661.1.66229 WP_003898661.1.66276 WP_003898661.1.66293 WP_003898661.1.66297 WP_003898661.1.66323 WP_003898661.1.66325 WP_003898661.1.6633 WP_003898661.1.66334 WP_003898661.1.66355 WP_003898661.1.66367 WP_003898661.1.66394 WP_003898661.1.66396 WP_003898661.1.66451 WP_003898661.1.66455 WP_003898661.1.66457 WP_003898661.1.66460 WP_003898661.1.66464 WP_003898661.1.66466 WP_003898661.1.66487 WP_003898661.1.66504 WP_003898661.1.66544 WP_003898661.1.66558 WP_003898661.1.66580 WP_003898661.1.66582 WP_003898661.1.66612 WP_003898661.1.66615 WP_003898661.1.66617 WP_003898661.1.66635 WP_003898661.1.66656 WP_003898661.1.66663 WP_003898661.1.66675 WP_003898661.1.66715 WP_003898661.1.66718 WP_003898661.1.66762 WP_003898661.1.66776 WP_003898661.1.66808 WP_003898661.1.66817 WP_003898661.1.66819 WP_003898661.1.66826 WP_003898661.1.66830 WP_003898661.1.66842 WP_003898661.1.66868 WP_003898661.1.66878 WP_003898661.1.66880 WP_003898661.1.66893 WP_003898661.1.66961 WP_003898661.1.67005 WP_003898661.1.6704 WP_003898661.1.67044 WP_003898661.1.67061 WP_003898661.1.67089 WP_003898661.1.67098 WP_003898661.1.67146 WP_003898661.1.67170 WP_003898661.1.67197 WP_003898661.1.6720 WP_003898661.1.67207 WP_003898661.1.67218 WP_003898661.1.67220 WP_003898661.1.67225 WP_003898661.1.67231 WP_003898661.1.6724 WP_003898661.1.67257 WP_003898661.1.67298 WP_003898661.1.67307 WP_003898661.1.67324 WP_003898661.1.67332 WP_003898661.1.67346 WP_003898661.1.67360 WP_003898661.1.67381 WP_003898661.1.67396 WP_003898661.1.67417 WP_003898661.1.67422 WP_003898661.1.67453 WP_003898661.1.67459 WP_003898661.1.6746 WP_003898661.1.67473 WP_003898661.1.67482 WP_003898661.1.67496 WP_003898661.1.67499 WP_003898661.1.67523 WP_003898661.1.67536 WP_003898661.1.67575 WP_003898661.1.67587 WP_003898661.1.67598 WP_003898661.1.67600 WP_003898661.1.67602 WP_003898661.1.67630 WP_003898661.1.67679 WP_003898661.1.67692 WP_003898661.1.67744 WP_003898661.1.6775 WP_003898661.1.67750 WP_003898661.1.6777 WP_003898661.1.67809 WP_003898661.1.67816 WP_003898661.1.67844 WP_003898661.1.67848 WP_003898661.1.67870 WP_003898661.1.67888 WP_003898661.1.67915 WP_003898661.1.67945 WP_003898661.1.67949 WP_003898661.1.67980 WP_003898661.1.67982 WP_003898661.1.68022 WP_003898661.1.68029 WP_003898661.1.68037 WP_003898661.1.68038 WP_003898661.1.68045 WP_003898661.1.68057 WP_003898661.1.68083 WP_003898661.1.68088 WP_003898661.1.68106 WP_003898661.1.68110 WP_003898661.1.68153 WP_003898661.1.68164 WP_003898661.1.68169 WP_003898661.1.68193 WP_003898661.1.68212 WP_003898661.1.68227 WP_003898661.1.68243 WP_003898661.1.6825 WP_003898661.1.68297 WP_003898661.1.68309 WP_003898661.1.68325 WP_003898661.1.68329 WP_003898661.1.68340 WP_003898661.1.68384 WP_003898661.1.68388 WP_003898661.1.6843 WP_003898661.1.68433 WP_003898661.1.68444 WP_003898661.1.68465 WP_003898661.1.68518 WP_003898661.1.68569 WP_003898661.1.68576 WP_003898661.1.68580 WP_003898661.1.68586 WP_003898661.1.68623 WP_003898661.1.68624 WP_003898661.1.68637 WP_003898661.1.68646 WP_003898661.1.68667 WP_003898661.1.68669 WP_003898661.1.68672 WP_003898661.1.68684 WP_003898661.1.68704 WP_003898661.1.68708 WP_003898661.1.6872 WP_003898661.1.68730 WP_003898661.1.68734 WP_003898661.1.68748 WP_003898661.1.68754 WP_003898661.1.6876 WP_003898661.1.68761 WP_003898661.1.68763 WP_003898661.1.68766 WP_003898661.1.68774 WP_003898661.1.68796 WP_003898661.1.68824 WP_003898661.1.68832 WP_003898661.1.68833 WP_003898661.1.68841 WP_003898661.1.68859 WP_003898661.1.68876 WP_003898661.1.68906 WP_003898661.1.68916 WP_003898661.1.68923 WP_003898661.1.68945 WP_003898661.1.6896 WP_003898661.1.68981 WP_003898661.1.68984 WP_003898661.1.68997 WP_003898661.1.69008 WP_003898661.1.69076 WP_003898661.1.69079 WP_003898661.1.6908 WP_003898661.1.69082 WP_003898661.1.69178 WP_003898661.1.69181 WP_003898661.1.69208 WP_003898661.1.69231 WP_003898661.1.69256 WP_003898661.1.69311 WP_003898661.1.69315 WP_003898661.1.69322 WP_003898661.1.69342 WP_003898661.1.6935 WP_003898661.1.6936 WP_003898661.1.69369 WP_003898661.1.69374 WP_003898661.1.69398 WP_003898661.1.69401 WP_003898661.1.69426 WP_003898661.1.69427 WP_003898661.1.69429 WP_003898661.1.6949 WP_003898661.1.6951 WP_003898661.1.69511 WP_003898661.1.69526 WP_003898661.1.69528 WP_003898661.1.69547 WP_003898661.1.69573 WP_003898661.1.69581 WP_003898661.1.6960 WP_003898661.1.69617 WP_003898661.1.69634 WP_003898661.1.69647 WP_003898661.1.69659 WP_003898661.1.69673 WP_003898661.1.69682 WP_003898661.1.69684 WP_003898661.1.69686 WP_003898661.1.69707 WP_003898661.1.69709 WP_003898661.1.69723 WP_003898661.1.69736 WP_003898661.1.69778 WP_003898661.1.69800 WP_003898661.1.69802 WP_003898661.1.69845 WP_003898661.1.69870 WP_003898661.1.69873 WP_003898661.1.69898 WP_003898661.1.69913 WP_003898661.1.69925 WP_003898661.1.69931 WP_003898661.1.69955 WP_003898661.1.69981 WP_003898661.1.69990 WP_003898661.1.70 WP_003898661.1.70000 WP_003898661.1.70017 WP_003898661.1.70032 WP_003898661.1.70055 WP_003898661.1.70072 WP_003898661.1.70131 WP_003898661.1.70132 WP_003898661.1.7022 WP_003898661.1.70227 WP_003898661.1.70255 WP_003898661.1.70271 WP_003898661.1.70274 WP_003898661.1.7029 WP_003898661.1.70325 WP_003898661.1.70328 WP_003898661.1.70356 WP_003898661.1.70364 WP_003898661.1.70368 WP_003898661.1.70418 WP_003898661.1.70422 WP_003898661.1.70444 WP_003898661.1.70463 WP_003898661.1.70471 WP_003898661.1.70480 WP_003898661.1.70494 WP_003898661.1.70498 WP_003898661.1.70505 WP_003898661.1.70573 WP_003898661.1.70577 WP_003898661.1.70610 WP_003898661.1.70615 WP_003898661.1.70618 WP_003898661.1.70622 WP_003898661.1.70626 WP_003898661.1.70668 WP_003898661.1.70699 WP_003898661.1.70704 WP_003898661.1.70729 WP_003898661.1.70757 WP_003898661.1.70782 WP_003898661.1.70830 WP_003898661.1.70834 WP_003898661.1.7084 WP_003898661.1.70840 WP_003898661.1.70864 WP_003898661.1.70871 WP_003898661.1.70915 WP_003898661.1.70958 WP_003898661.1.70964 WP_003898661.1.70976 WP_003898661.1.71015 WP_003898661.1.71026 WP_003898661.1.71063 WP_003898661.1.71076 WP_003898661.1.71083 WP_003898661.1.7111 WP_003898661.1.71128 WP_003898661.1.7113 WP_003898661.1.71187 WP_003898661.1.71191 WP_003898661.1.71255 WP_003898661.1.71258 WP_003898661.1.71259 WP_003898661.1.71289 WP_003898661.1.71326 WP_003898661.1.71329 WP_003898661.1.71331 WP_003898661.1.71344 WP_003898661.1.71390 WP_003898661.1.71440 WP_003898661.1.71457 WP_003898661.1.7146 WP_003898661.1.71464 WP_003898661.1.71490 WP_003898661.1.71492 WP_003898661.1.71509 WP_003898661.1.71516 WP_003898661.1.71517 WP_003898661.1.71527 WP_003898661.1.71532 WP_003898661.1.71545 WP_003898661.1.71546 WP_003898661.1.71569 WP_003898661.1.71604 WP_003898661.1.71621 WP_003898661.1.71630 WP_003898661.1.71654 WP_003898661.1.71664 WP_003898661.1.71665 WP_003898661.1.71683 WP_003898661.1.71701 WP_003898661.1.71718 WP_003898661.1.71731 WP_003898661.1.71778 WP_003898661.1.71781 WP_003898661.1.71803 WP_003898661.1.71820 WP_003898661.1.71847 WP_003898661.1.7185 WP_003898661.1.71851 WP_003898661.1.71871 WP_003898661.1.71909 WP_003898661.1.71957 WP_003898661.1.71970 WP_003898661.1.72047 WP_003898661.1.72061 WP_003898661.1.72062 WP_003898661.1.72072 WP_003898661.1.72111 WP_003898661.1.72122 WP_003898661.1.72128 WP_003898661.1.72143 WP_003898661.1.7216 WP_003898661.1.72168 WP_003898661.1.72179 WP_003898661.1.72209 WP_003898661.1.72218 WP_003898661.1.72219 WP_003898661.1.72227 WP_003898661.1.7224 WP_003898661.1.72268 WP_003898661.1.72332 WP_003898661.1.72380 WP_003898661.1.72401 WP_003898661.1.72405 WP_003898661.1.72420 WP_003898661.1.72441 WP_003898661.1.72451 WP_003898661.1.72452 WP_003898661.1.72457 WP_003898661.1.72459 WP_003898661.1.72460 WP_003898661.1.72466 WP_003898661.1.72487 WP_003898661.1.72488 WP_003898661.1.72492 WP_003898661.1.72506 WP_003898661.1.72543 WP_003898661.1.7256 WP_003898661.1.72576 WP_003898661.1.72578 WP_003898661.1.72585 WP_003898661.1.72591 WP_003898661.1.72592 WP_003898661.1.72640 WP_003898661.1.7266 WP_003898661.1.72661 WP_003898661.1.72684 WP_003898661.1.72739 WP_003898661.1.72744 WP_003898661.1.72755 WP_003898661.1.72759 WP_003898661.1.72784 WP_003898661.1.72792 WP_003898661.1.72826 WP_003898661.1.72831 WP_003898661.1.72852 WP_003898661.1.72853 WP_003898661.1.72879 WP_003898661.1.72880 WP_003898661.1.72938 WP_003898661.1.72954 WP_003898661.1.72957 WP_003898661.1.72959 WP_003898661.1.72973 WP_003898661.1.7298 WP_003898661.1.72982 WP_003898661.1.72988 WP_003898661.1.72993 WP_003898661.1.73006 WP_003898661.1.73013 WP_003898661.1.73025 WP_003898661.1.73028 WP_003898661.1.73045 WP_003898661.1.73092 WP_003898661.1.73118 WP_003898661.1.7312 WP_003898661.1.73127 WP_003898661.1.73134 WP_003898661.1.73150 WP_003898661.1.73154 WP_003898661.1.73163 WP_003898661.1.73182 WP_003898661.1.73205 WP_003898661.1.7321 WP_003898661.1.73310 WP_003898661.1.73365 WP_003898661.1.73391 WP_003898661.1.73404 WP_003898661.1.73424 WP_003898661.1.73436 WP_003898661.1.73445 WP_003898661.1.73453 WP_003898661.1.73465 WP_003898661.1.73466 WP_003898661.1.73470 WP_003898661.1.73471 WP_003898661.1.73478 WP_003898661.1.73482 WP_003898661.1.73507 WP_003898661.1.73532 WP_003898661.1.73550 WP_003898661.1.73564 WP_003898661.1.73623 WP_003898661.1.73629 WP_003898661.1.73644 WP_003898661.1.7366 WP_003898661.1.73661 WP_003898661.1.7368 WP_003898661.1.73688 WP_003898661.1.73723 WP_003898661.1.73744 WP_003898661.1.73750 WP_003898661.1.73760 WP_003898661.1.73774 WP_003898661.1.7379 WP_003898661.1.73813 WP_003898661.1.73840 WP_003898661.1.73876 WP_003898661.1.7389 WP_003898661.1.73986 WP_003898661.1.74016 WP_003898661.1.74039 WP_003898661.1.74083 WP_003898661.1.74101 WP_003898661.1.74107 WP_003898661.1.74129 WP_003898661.1.74144 WP_003898661.1.7417 WP_003898661.1.74190 WP_003898661.1.74210 WP_003898661.1.7423 WP_003898661.1.74262 WP_003898661.1.74269 WP_003898661.1.74282 WP_003898661.1.74291 WP_003898661.1.74296 WP_003898661.1.74304 WP_003898661.1.7432 WP_003898661.1.74347 WP_003898661.1.7436 WP_003898661.1.74378 WP_003898661.1.74382 WP_003898661.1.74395 WP_003898661.1.74400 WP_003898661.1.74432 WP_003898661.1.74442 WP_003898661.1.74477 WP_003898661.1.74487 WP_003898661.1.74499 WP_003898661.1.74504 WP_003898661.1.74511 WP_003898661.1.74523 WP_003898661.1.74525 WP_003898661.1.74551 WP_003898661.1.74555 WP_003898661.1.74628 WP_003898661.1.74641 WP_003898661.1.74653 WP_003898661.1.74660 WP_003898661.1.74683 WP_003898661.1.7469 WP_003898661.1.74725 WP_003898661.1.74760 WP_003898661.1.74786 WP_003898661.1.74809 WP_003898661.1.74820 WP_003898661.1.74870 WP_003898661.1.74881 WP_003898661.1.74888 WP_003898661.1.74952 WP_003898661.1.7496 WP_003898661.1.74988 WP_003898661.1.75043 WP_003898661.1.75045 WP_003898661.1.75055 WP_003898661.1.75078 WP_003898661.1.75081 WP_003898661.1.75120 WP_003898661.1.75163 WP_003898661.1.75188 WP_003898661.1.75202 WP_003898661.1.75234 WP_003898661.1.75239 WP_003898661.1.75263 WP_003898661.1.75342 WP_003898661.1.7535 WP_003898661.1.75376 WP_003898661.1.75391 WP_003898661.1.75395 WP_003898661.1.75441 WP_003898661.1.75510 WP_003898661.1.75581 WP_003898661.1.75598 WP_003898661.1.75635 WP_003898661.1.75645 WP_003898661.1.75665 WP_003898661.1.75749 WP_003898661.1.75772 WP_003898661.1.75774 WP_003898661.1.75811 WP_003898661.1.75833 WP_003898661.1.7585 WP_003898661.1.75868 WP_003898661.1.75878 WP_003898661.1.75927 WP_003898661.1.75946 WP_003898661.1.75968 WP_003898661.1.75974 WP_003898661.1.76007 WP_003898661.1.76016 WP_003898661.1.76032 WP_003898661.1.76037 WP_003898661.1.7604 WP_003898661.1.76052 WP_003898661.1.76058 WP_003898661.1.76064 WP_003898661.1.76110 WP_003898661.1.76126 WP_003898661.1.76133 WP_003898661.1.76138 WP_003898661.1.76157 WP_003898661.1.76172 WP_003898661.1.76177 WP_003898661.1.76183 WP_003898661.1.76209 WP_003898661.1.76239 WP_003898661.1.76272 WP_003898661.1.76277 WP_003898661.1.76280 WP_003898661.1.76281 WP_003898661.1.76291 WP_003898661.1.76297 WP_003898661.1.76360 WP_003898661.1.76379 WP_003898661.1.76403 WP_003898661.1.76413 WP_003898661.1.76414 WP_003898661.1.76427 WP_003898661.1.76436 WP_003898661.1.76442 WP_003898661.1.76443 WP_003898661.1.76456 WP_003898661.1.76521 WP_003898661.1.76533 WP_003898661.1.76616 WP_003898661.1.76625 WP_003898661.1.76629 WP_003898661.1.76638 WP_003898661.1.76639 WP_003898661.1.76640 WP_003898661.1.76644 WP_003898661.1.76677 WP_003898661.1.76678 WP_003898661.1.76679 WP_003898661.1.76734 WP_003898661.1.76744 WP_003898661.1.76750 WP_003898661.1.76754 WP_003898661.1.76757 WP_003898661.1.76781 WP_003898661.1.76818 WP_003898661.1.76824 WP_003898661.1.76835 WP_003898661.1.76873 WP_003898661.1.76881 WP_003898661.1.76888 WP_003898661.1.76900 WP_003898661.1.7691 WP_003898661.1.76947 WP_003898661.1.76954 WP_003898661.1.76955 WP_003898661.1.76963 WP_003898661.1.76976 WP_003898661.1.770 WP_003898661.1.77000 WP_003898661.1.77008 WP_003898661.1.77021 WP_003898661.1.77056 WP_003898661.1.77065 WP_003898661.1.77075 WP_003898661.1.77093 WP_003898661.1.77107 WP_003898661.1.77115 WP_003898661.1.77118 WP_003898661.1.77125 WP_003898661.1.77141 WP_003898661.1.77142 WP_003898661.1.77166 WP_003898661.1.77250 WP_003898661.1.77260 WP_003898661.1.77266 WP_003898661.1.77285 WP_003898661.1.77312 WP_003898661.1.77348 WP_003898661.1.77351 WP_003898661.1.77352 WP_003898661.1.77361 WP_003898661.1.774 WP_003898661.1.7740 WP_003898661.1.77404 WP_003898661.1.77425 WP_003898661.1.77463 WP_003898661.1.77474 WP_003898661.1.7748 WP_003898661.1.77484 WP_003898661.1.77491 WP_003898661.1.77499 WP_003898661.1.77510 WP_003898661.1.77530 WP_003898661.1.77554 WP_003898661.1.77559 WP_003898661.1.77599 WP_003898661.1.77605 WP_003898661.1.7762 WP_003898661.1.77627 WP_003898661.1.77649 WP_003898661.1.77654 WP_003898661.1.7766 WP_003898661.1.77667 WP_003898661.1.77704 WP_003898661.1.77706 WP_003898661.1.77726 WP_003898661.1.77774 WP_003898661.1.7778 WP_003898661.1.77790 WP_003898661.1.77809 WP_003898661.1.77820 WP_003898661.1.77843 WP_003898661.1.77855 WP_003898661.1.77865 WP_003898661.1.77868 WP_003898661.1.77879 WP_003898661.1.77890 WP_003898661.1.77909 WP_003898661.1.77911 WP_003898661.1.77931 WP_003898661.1.77984 WP_003898661.1.78020 WP_003898661.1.78024 WP_003898661.1.78075 WP_003898661.1.78084 WP_003898661.1.78086 WP_003898661.1.7809 WP_003898661.1.78105 WP_003898661.1.78113 WP_003898661.1.78136 WP_003898661.1.78162 WP_003898661.1.7817 WP_003898661.1.78200 WP_003898661.1.78216 WP_003898661.1.78236 WP_003898661.1.78238 WP_003898661.1.78322 WP_003898661.1.7836 WP_003898661.1.78360 WP_003898661.1.78386 WP_003898661.1.78429 WP_003898661.1.78435 WP_003898661.1.7844 WP_003898661.1.78459 WP_003898661.1.78488 WP_003898661.1.78499 WP_003898661.1.785 WP_003898661.1.78516 WP_003898661.1.78524 WP_003898661.1.78526 WP_003898661.1.78538 WP_003898661.1.78544 WP_003898661.1.78545 WP_003898661.1.78547 WP_003898661.1.78574 WP_003898661.1.78580 WP_003898661.1.7860 WP_003898661.1.78620 WP_003898661.1.78646 WP_003898661.1.78648 WP_003898661.1.78649 WP_003898661.1.78655 WP_003898661.1.78657 WP_003898661.1.78659 WP_003898661.1.78692 WP_003898661.1.78760 WP_003898661.1.78766 WP_003898661.1.78776 WP_003898661.1.78778 WP_003898661.1.78784 WP_003898661.1.78788 WP_003898661.1.78790 WP_003898661.1.78793 WP_003898661.1.78848 WP_003898661.1.78860 WP_003898661.1.7887 WP_003898661.1.78884 WP_003898661.1.78932 WP_003898661.1.78969 WP_003898661.1.78977 WP_003898661.1.78980 WP_003898661.1.79005 WP_003898661.1.79016 WP_003898661.1.79033 WP_003898661.1.79064 WP_003898661.1.79066 WP_003898661.1.79068 WP_003898661.1.79095 WP_003898661.1.79112 WP_003898661.1.79122 WP_003898661.1.79145 WP_003898661.1.79152 WP_003898661.1.79163 WP_003898661.1.79182 WP_003898661.1.79198 WP_003898661.1.79213 WP_003898661.1.79218 WP_003898661.1.79268 WP_003898661.1.79273 WP_003898661.1.79278 WP_003898661.1.79290 WP_003898661.1.79319 WP_003898661.1.79325 WP_003898661.1.79326 WP_003898661.1.7933 WP_003898661.1.79330 WP_003898661.1.79339 WP_003898661.1.79394 WP_003898661.1.79399 WP_003898661.1.79413 WP_003898661.1.79422 WP_003898661.1.79445 WP_003898661.1.79447 WP_003898661.1.79455 WP_003898661.1.79471 WP_003898661.1.79480 WP_003898661.1.79482 WP_003898661.1.79488 WP_003898661.1.79500 WP_003898661.1.79502 WP_003898661.1.79508 WP_003898661.1.79514 WP_003898661.1.79561 WP_003898661.1.79565 WP_003898661.1.79578 WP_003898661.1.79588 WP_003898661.1.79598 WP_003898661.1.79615 WP_003898661.1.79684 WP_003898661.1.79698 WP_003898661.1.797 WP_003898661.1.79744 WP_003898661.1.79784 WP_003898661.1.79802 WP_003898661.1.79806 WP_003898661.1.79819 WP_003898661.1.79826 WP_003898661.1.79828 WP_003898661.1.79851 WP_003898661.1.79853 WP_003898661.1.79863 WP_003898661.1.79881 WP_003898661.1.79885 WP_003898661.1.79898 WP_003898661.1.7990 WP_003898661.1.79900 WP_003898661.1.79913 WP_003898661.1.79918 WP_003898661.1.79947 WP_003898661.1.79948 WP_003898661.1.7995 WP_003898661.1.7997 WP_003898661.1.80004 WP_003898661.1.80022 WP_003898661.1.80030 WP_003898661.1.80054 WP_003898661.1.80084 WP_003898661.1.80099 WP_003898661.1.80129 WP_003898661.1.80177 WP_003898661.1.80234 WP_003898661.1.8026 WP_003898661.1.80275 WP_003898661.1.8029 WP_003898661.1.80299 WP_003898661.1.80300 WP_003898661.1.80304 WP_003898661.1.80326 WP_003898661.1.80351 WP_003898661.1.8037 WP_003898661.1.80370 WP_003898661.1.80387 WP_003898661.1.80399 WP_003898661.1.8044 WP_003898661.1.80451 WP_003898661.1.80458 WP_003898661.1.80461 WP_003898661.1.80490 WP_003898661.1.80503 WP_003898661.1.80507 WP_003898661.1.80552 WP_003898661.1.80576 WP_003898661.1.80588 WP_003898661.1.80599 WP_003898661.1.8060 WP_003898661.1.80624 WP_003898661.1.80636 WP_003898661.1.80711 WP_003898661.1.80714 WP_003898661.1.80743 WP_003898661.1.80784 WP_003898661.1.80815 WP_003898661.1.80853 WP_003898661.1.80918 WP_003898661.1.8093 WP_003898661.1.80967 WP_003898661.1.8097 WP_003898661.1.80988 WP_003898661.1.81007 WP_003898661.1.81013 WP_003898661.1.8105 WP_003898661.1.81059 WP_003898661.1.81063 WP_003898661.1.81066 WP_003898661.1.81075 WP_003898661.1.81091 WP_003898661.1.81119 WP_003898661.1.81125 WP_003898661.1.81136 WP_003898661.1.8114 WP_003898661.1.81189 WP_003898661.1.81192 WP_003898661.1.812 WP_003898661.1.81230 WP_003898661.1.81249 WP_003898661.1.81250 WP_003898661.1.81264 WP_003898661.1.8128 WP_003898661.1.81287 WP_003898661.1.81297 WP_003898661.1.8138 WP_003898661.1.81407 WP_003898661.1.8143 WP_003898661.1.81439 WP_003898661.1.81465 WP_003898661.1.81505 WP_003898661.1.81529 WP_003898661.1.81538 WP_003898661.1.81541 WP_003898661.1.81560 WP_003898661.1.81561 WP_003898661.1.81567 WP_003898661.1.81583 WP_003898661.1.81686 WP_003898661.1.81712 WP_003898661.1.81720 WP_003898661.1.81731 WP_003898661.1.81774 WP_003898661.1.81788 WP_003898661.1.81809 WP_003898661.1.81820 WP_003898661.1.81850 WP_003898661.1.81883 WP_003898661.1.81891 WP_003898661.1.81911 WP_003898661.1.81918 WP_003898661.1.82011 WP_003898661.1.82048 WP_003898661.1.82069 WP_003898661.1.82071 WP_003898661.1.82108 WP_003898661.1.82136 WP_003898661.1.82142 WP_003898661.1.8215 WP_003898661.1.82158 WP_003898661.1.8217 WP_003898661.1.82209 WP_003898661.1.82210 WP_003898661.1.82228 WP_003898661.1.82236 WP_003898661.1.82251 WP_003898661.1.82305 WP_003898661.1.82307 WP_003898661.1.82309 WP_003898661.1.82317 WP_003898661.1.8232 WP_003898661.1.82346 WP_003898661.1.82374 WP_003898661.1.82385 WP_003898661.1.82429 WP_003898661.1.82460 WP_003898661.1.82483 WP_003898661.1.82494 WP_003898661.1.82531 WP_003898661.1.82546 WP_003898661.1.82549 WP_003898661.1.82577 WP_003898661.1.82592 WP_003898661.1.82597 WP_003898661.1.82598 WP_003898661.1.82625 WP_003898661.1.82642 WP_003898661.1.82651 WP_003898661.1.82653 WP_003898661.1.82681 WP_003898661.1.82685 WP_003898661.1.8271 WP_003898661.1.82712 WP_003898661.1.8273 WP_003898661.1.82743 WP_003898661.1.82757 WP_003898661.1.82774 WP_003898661.1.82803 WP_003898661.1.82836 WP_003898661.1.82860 WP_003898661.1.82871 WP_003898661.1.82892 WP_003898661.1.82935 WP_003898661.1.82957 WP_003898661.1.82973 WP_003898661.1.82981 WP_003898661.1.82983 WP_003898661.1.83004 WP_003898661.1.83009 WP_003898661.1.83044 WP_003898661.1.83065 WP_003898661.1.83074 WP_003898661.1.83110 WP_003898661.1.83146 WP_003898661.1.83149 WP_003898661.1.83159 WP_003898661.1.8317 WP_003898661.1.83173 WP_003898661.1.83181 WP_003898661.1.83182 WP_003898661.1.83191 WP_003898661.1.83197 WP_003898661.1.83212 WP_003898661.1.8326 WP_003898661.1.83262 WP_003898661.1.83268 WP_003898661.1.83273 WP_003898661.1.83309 WP_003898661.1.83332 WP_003898661.1.83334 WP_003898661.1.83341 WP_003898661.1.83349 WP_003898661.1.8335 WP_003898661.1.83353 WP_003898661.1.83367 WP_003898661.1.83380 WP_003898661.1.83381 WP_003898661.1.83389 WP_003898661.1.83408 WP_003898661.1.83409 WP_003898661.1.83435 WP_003898661.1.83470 WP_003898661.1.83524 WP_003898661.1.83526 WP_003898661.1.8358 WP_003898661.1.83589 WP_003898661.1.83601 WP_003898661.1.83611 WP_003898661.1.83638 WP_003898661.1.83648 WP_003898661.1.83656 WP_003898661.1.83667 WP_003898661.1.83689 WP_003898661.1.83692 WP_003898661.1.83705 WP_003898661.1.83766 WP_003898661.1.83793 WP_003898661.1.83794 WP_003898661.1.83802 WP_003898661.1.83805 WP_003898661.1.83839 WP_003898661.1.83842 WP_003898661.1.83850 WP_003898661.1.83861 WP_003898661.1.83884 WP_003898661.1.83920 WP_003898661.1.83929 WP_003898661.1.83930 WP_003898661.1.83975 WP_003898661.1.83991 WP_003898661.1.8400 WP_003898661.1.84027 WP_003898661.1.8404 WP_003898661.1.84057 WP_003898661.1.84070 WP_003898661.1.8409 WP_003898661.1.84112 WP_003898661.1.84146 WP_003898661.1.8415 WP_003898661.1.84176 WP_003898661.1.84192 WP_003898661.1.84228 WP_003898661.1.8424 WP_003898661.1.84244 WP_003898661.1.84259 WP_003898661.1.8426 WP_003898661.1.84277 WP_003898661.1.84287 WP_003898661.1.8434 WP_003898661.1.84388 WP_003898661.1.84409 WP_003898661.1.84438 WP_003898661.1.84460 WP_003898661.1.84488 WP_003898661.1.84504 WP_003898661.1.84525 WP_003898661.1.84620 WP_003898661.1.84623 WP_003898661.1.84641 WP_003898661.1.84655 WP_003898661.1.84666 WP_003898661.1.84670 WP_003898661.1.84739 WP_003898661.1.84748 WP_003898661.1.84766 WP_003898661.1.84772 WP_003898661.1.84774 WP_003898661.1.848 WP_003898661.1.84812 WP_003898661.1.84836 WP_003898661.1.84839 WP_003898661.1.84873 WP_003898661.1.84911 WP_003898661.1.84938 WP_003898661.1.84968 WP_003898661.1.84973 WP_003898661.1.84981 WP_003898661.1.84985 WP_003898661.1.8503 WP_003898661.1.85038 WP_003898661.1.85041 WP_003898661.1.85043 WP_003898661.1.8505 WP_003898661.1.85074 WP_003898661.1.8509 WP_003898661.1.8512 WP_003898661.1.85148 WP_003898661.1.8518 WP_003898661.1.8522 WP_003898661.1.85242 WP_003898661.1.85276 WP_003898661.1.85281 WP_003898661.1.85284 WP_003898661.1.85314 WP_003898661.1.85319 WP_003898661.1.85330 WP_003898661.1.85341 WP_003898661.1.8535 WP_003898661.1.85363 WP_003898661.1.85371 WP_003898661.1.85377 WP_003898661.1.85387 WP_003898661.1.85399 WP_003898661.1.85458 WP_003898661.1.8546 WP_003898661.1.85464 WP_003898661.1.85478 WP_003898661.1.85480 WP_003898661.1.85488 WP_003898661.1.85495 WP_003898661.1.85551 WP_003898661.1.85557 WP_003898661.1.85577 WP_003898661.1.85599 WP_003898661.1.85610 WP_003898661.1.8563 WP_003898661.1.85648 WP_003898661.1.85679 WP_003898661.1.85704 WP_003898661.1.85727 WP_003898661.1.85763 WP_003898661.1.85808 WP_003898661.1.85819 WP_003898661.1.85820 WP_003898661.1.85823 WP_003898661.1.85832 WP_003898661.1.8586 WP_003898661.1.85872 WP_003898661.1.85894 WP_003898661.1.85909 WP_003898661.1.85913 WP_003898661.1.85953 WP_003898661.1.85986 WP_003898661.1.86000 WP_003898661.1.86024 WP_003898661.1.86025 WP_003898661.1.86032 WP_003898661.1.86048 WP_003898661.1.86052 WP_003898661.1.86067 WP_003898661.1.86103 WP_003898661.1.86122 WP_003898661.1.86124 WP_003898661.1.86160 WP_003898661.1.86164 WP_003898661.1.86168 WP_003898661.1.86190 WP_003898661.1.86204 WP_003898661.1.86235 WP_003898661.1.86249 WP_003898661.1.86260 WP_003898661.1.86290 WP_003898661.1.863 WP_003898661.1.86327 WP_003898661.1.86334 WP_003898661.1.86337 WP_003898661.1.86368 WP_003898661.1.86377 WP_003898661.1.86425 WP_003898661.1.86459 WP_003898661.1.8649 WP_003898661.1.86499 WP_003898661.1.86520 WP_003898661.1.86561 WP_003898661.1.86568 WP_003898661.1.86575 WP_003898661.1.86584 WP_003898661.1.86605 WP_003898661.1.86626 WP_003898661.1.86648 WP_003898661.1.8666 WP_003898661.1.86684 WP_003898661.1.86696 WP_003898661.1.86705 WP_003898661.1.86718 WP_003898661.1.86725 WP_003898661.1.86757 WP_003898661.1.86766 WP_003898661.1.86801 WP_003898661.1.86814 WP_003898661.1.86820 WP_003898661.1.86825 WP_003898661.1.86834 WP_003898661.1.8685 WP_003898661.1.86851 WP_003898661.1.86855 WP_003898661.1.86867 WP_003898661.1.86877 WP_003898661.1.86883 WP_003898661.1.8689 WP_003898661.1.86892 WP_003898661.1.86933 WP_003898661.1.86941 WP_003898661.1.86950 WP_003898661.1.86962 WP_003898661.1.86963 WP_003898661.1.86979 WP_003898661.1.8700 WP_003898661.1.87001 WP_003898661.1.87002 WP_003898661.1.87031 WP_003898661.1.87116 WP_003898661.1.87117 WP_003898661.1.8714 WP_003898661.1.87162 WP_003898661.1.87178 WP_003898661.1.87191 WP_003898661.1.87201 WP_003898661.1.87209 WP_003898661.1.87240 WP_003898661.1.87266 WP_003898661.1.87273 WP_003898661.1.87275 WP_003898661.1.8733 WP_003898661.1.87345 WP_003898661.1.87369 WP_003898661.1.8737 WP_003898661.1.87401 WP_003898661.1.87404 WP_003898661.1.87406 WP_003898661.1.87409 WP_003898661.1.87444 WP_003898661.1.87446 WP_003898661.1.87459 WP_003898661.1.87472 WP_003898661.1.87489 WP_003898661.1.87494 WP_003898661.1.87496 WP_003898661.1.87582 WP_003898661.1.87588 WP_003898661.1.87617 WP_003898661.1.87619 WP_003898661.1.87620 WP_003898661.1.87634 WP_003898661.1.87643 WP_003898661.1.8765 WP_003898661.1.87650 WP_003898661.1.87654 WP_003898661.1.87658 WP_003898661.1.87665 WP_003898661.1.87676 WP_003898661.1.87677 WP_003898661.1.87684 WP_003898661.1.87692 WP_003898661.1.87707 WP_003898661.1.87732 WP_003898661.1.87784 WP_003898661.1.87796 WP_003898661.1.87809 WP_003898661.1.87817 WP_003898661.1.87827 WP_003898661.1.87831 WP_003898661.1.87835 WP_003898661.1.87837 WP_003898661.1.87866 WP_003898661.1.8789 WP_003898661.1.87911 WP_003898661.1.87924 WP_003898661.1.87951 WP_003898661.1.87955 WP_003898661.1.87956 WP_003898661.1.87991 WP_003898661.1.88 WP_003898661.1.88002 WP_003898661.1.88037 WP_003898661.1.88039 WP_003898661.1.88072 WP_003898661.1.88077 WP_003898661.1.88121 WP_003898661.1.88191 WP_003898661.1.88205 WP_003898661.1.88217 WP_003898661.1.88219 WP_003898661.1.88245 WP_003898661.1.88253 WP_003898661.1.88294 WP_003898661.1.88315 WP_003898661.1.88316 WP_003898661.1.88320 WP_003898661.1.88338 WP_003898661.1.8840 WP_003898661.1.88437 WP_003898661.1.88453 WP_003898661.1.88469 WP_003898661.1.88489 WP_003898661.1.88507 WP_003898661.1.88521 WP_003898661.1.88530 WP_003898661.1.88537 WP_003898661.1.88541 WP_003898661.1.88592 WP_003898661.1.88616 WP_003898661.1.88618 WP_003898661.1.8862 WP_003898661.1.88625 WP_003898661.1.88632 WP_003898661.1.88634 WP_003898661.1.88649 WP_003898661.1.8870 WP_003898661.1.88737 WP_003898661.1.88756 WP_003898661.1.888 WP_003898661.1.88824 WP_003898661.1.88886 WP_003898661.1.88965 WP_003898661.1.8902 WP_003898661.1.89025 WP_003898661.1.89041 WP_003898661.1.89046 WP_003898661.1.89162 WP_003898661.1.89168 WP_003898661.1.8917 WP_003898661.1.89193 WP_003898661.1.89205 WP_003898661.1.89207 WP_003898661.1.89225 WP_003898661.1.8925 WP_003898661.1.89286 WP_003898661.1.89293 WP_003898661.1.89320 WP_003898661.1.8935 WP_003898661.1.89371 WP_003898661.1.89378 WP_003898661.1.89392 WP_003898661.1.89406 WP_003898661.1.8943 WP_003898661.1.89451 WP_003898661.1.89453 WP_003898661.1.89473 WP_003898661.1.89475 WP_003898661.1.89483 WP_003898661.1.895 WP_003898661.1.89513 WP_003898661.1.89517 WP_003898661.1.89522 WP_003898661.1.8954 WP_003898661.1.89543 WP_003898661.1.89567 WP_003898661.1.8957 WP_003898661.1.89572 WP_003898661.1.89589 WP_003898661.1.89607 WP_003898661.1.89613 WP_003898661.1.89625 WP_003898661.1.89648 WP_003898661.1.8967 WP_003898661.1.89670 WP_003898661.1.89729 WP_003898661.1.89739 WP_003898661.1.89762 WP_003898661.1.8977 WP_003898661.1.89802 WP_003898661.1.89808 WP_003898661.1.8982 WP_003898661.1.89829 WP_003898661.1.89831 WP_003898661.1.89849 WP_003898661.1.8989 WP_003898661.1.89901 WP_003898661.1.89903 WP_003898661.1.89909 WP_003898661.1.89922 WP_003898661.1.89926 WP_003898661.1.89963 WP_003898661.1.89971 WP_003898661.1.8998 WP_003898661.1.89987 WP_003898661.1.900 WP_003898661.1.90048 WP_003898661.1.9007 WP_003898661.1.90080 WP_003898661.1.90130 WP_003898661.1.90134 WP_003898661.1.90137 WP_003898661.1.90157 WP_003898661.1.90184 WP_003898661.1.90199 WP_003898661.1.90231 WP_003898661.1.90245 WP_003898661.1.90308 WP_003898661.1.90322 WP_003898661.1.90328 WP_003898661.1.90372 WP_003898661.1.90481 WP_003898661.1.90499 WP_003898661.1.9050 WP_003898661.1.90550 WP_003898661.1.90560 WP_003898661.1.90612 WP_003898661.1.90640 WP_003898661.1.90672 WP_003898661.1.90687 WP_003898661.1.90691 WP_003898661.1.90711 WP_003898661.1.90722 WP_003898661.1.90744 WP_003898661.1.9075 WP_003898661.1.90756 WP_003898661.1.90767 WP_003898661.1.90771 WP_003898661.1.90785 WP_003898661.1.90788 WP_003898661.1.90800 WP_003898661.1.90810 WP_003898661.1.90816 WP_003898661.1.90819 WP_003898661.1.9082 WP_003898661.1.90831 WP_003898661.1.90884 WP_003898661.1.90899 WP_003898661.1.90906 WP_003898661.1.90958 WP_003898661.1.90976 WP_003898661.1.90977 WP_003898661.1.90987 WP_003898661.1.9102 WP_003898661.1.91026 WP_003898661.1.91032 WP_003898661.1.91053 WP_003898661.1.91082 WP_003898661.1.91106 WP_003898661.1.91112 WP_003898661.1.91144 WP_003898661.1.91151 WP_003898661.1.91157 WP_003898661.1.91167 WP_003898661.1.91169 WP_003898661.1.91192 WP_003898661.1.91201 WP_003898661.1.91207 WP_003898661.1.91208 WP_003898661.1.91211 WP_003898661.1.91214 WP_003898661.1.91244 WP_003898661.1.91251 WP_003898661.1.91260 WP_003898661.1.91265 WP_003898661.1.9128 WP_003898661.1.91284 WP_003898661.1.91294 WP_003898661.1.91303 WP_003898661.1.91322 WP_003898661.1.91386 WP_003898661.1.9139 WP_003898661.1.91398 WP_003898661.1.91411 WP_003898661.1.91430 WP_003898661.1.91436 WP_003898661.1.91483 WP_003898661.1.91496 WP_003898661.1.91507 WP_003898661.1.91508 WP_003898661.1.91576 WP_003898661.1.91694 WP_003898661.1.91695 WP_003898661.1.91713 WP_003898661.1.91716 WP_003898661.1.91717 WP_003898661.1.91728 WP_003898661.1.91743 WP_003898661.1.91759 WP_003898661.1.91784 WP_003898661.1.91785 WP_003898661.1.91786 WP_003898661.1.91802 WP_003898661.1.91822 WP_003898661.1.91828 WP_003898661.1.9189 WP_003898661.1.91896 WP_003898661.1.9190 WP_003898661.1.91915 WP_003898661.1.91931 WP_003898661.1.91937 WP_003898661.1.91944 WP_003898661.1.91953 WP_003898661.1.91957 WP_003898661.1.91976 WP_003898661.1.92021 WP_003898661.1.92083 WP_003898661.1.92127 WP_003898661.1.92144 WP_003898661.1.92150 WP_003898661.1.92153 WP_003898661.1.92190 WP_003898661.1.92192 WP_003898661.1.92200 WP_003898661.1.92220 WP_003898661.1.92221 WP_003898661.1.92222 WP_003898661.1.92289 WP_003898661.1.9229 WP_003898661.1.92294 WP_003898661.1.92300 WP_003898661.1.92317 WP_003898661.1.92334 WP_003898661.1.92338 WP_003898661.1.92345 WP_003898661.1.92356 WP_003898661.1.92364 WP_003898661.1.92380 WP_003898661.1.92416 WP_003898661.1.92428 WP_003898661.1.92447 WP_003898661.1.92456 WP_003898661.1.92467 WP_003898661.1.92471 WP_003898661.1.92490 WP_003898661.1.92508 WP_003898661.1.9251 WP_003898661.1.92523 WP_003898661.1.92527 WP_003898661.1.92536 WP_003898661.1.92592 WP_003898661.1.92597 WP_003898661.1.92603 WP_003898661.1.92606 WP_003898661.1.92610 WP_003898661.1.92613 WP_003898661.1.9263 WP_003898661.1.9265 WP_003898661.1.92650 WP_003898661.1.92660 WP_003898661.1.92677 WP_003898661.1.92685 WP_003898661.1.92689 WP_003898661.1.92690 WP_003898661.1.92706 WP_003898661.1.92714 WP_003898661.1.92736 WP_003898661.1.92752 WP_003898661.1.92760 WP_003898661.1.92777 WP_003898661.1.92803 WP_003898661.1.92833 WP_003898661.1.92856 WP_003898661.1.92881 WP_003898661.1.92892 WP_003898661.1.92907 WP_003898661.1.92908 WP_003898661.1.9291 WP_003898661.1.92917 WP_003898661.1.92996 WP_003898661.1.93006 WP_003898661.1.93008 WP_003898661.1.93009 WP_003898661.1.93015 WP_003898661.1.93043 WP_003898661.1.9307 WP_003898661.1.93083 WP_003898661.1.93097 WP_003898661.1.93137 WP_003898661.1.93192 WP_003898661.1.93203 WP_003898661.1.93212 WP_003898661.1.93234 WP_003898661.1.93245 WP_003898661.1.93257 WP_003898661.1.93265 WP_003898661.1.93297 WP_003898661.1.93320 WP_003898661.1.93328 WP_003898661.1.93337 WP_003898661.1.93343 WP_003898661.1.93349 WP_003898661.1.93363 WP_003898661.1.93377 WP_003898661.1.9338 WP_003898661.1.93407 WP_003898661.1.93417 WP_003898661.1.93419 WP_003898661.1.93426 WP_003898661.1.9344 WP_003898661.1.93443 WP_003898661.1.93447 WP_003898661.1.93470 WP_003898661.1.93483 WP_003898661.1.93487 WP_003898661.1.93495 WP_003898661.1.93499 WP_003898661.1.93516 WP_003898661.1.93536 WP_003898661.1.93544 WP_003898661.1.93555 WP_003898661.1.93560 WP_003898661.1.93564 WP_003898661.1.9357 WP_003898661.1.93573 WP_003898661.1.93576 WP_003898661.1.93588 WP_003898661.1.9363 WP_003898661.1.93645 WP_003898661.1.93649 WP_003898661.1.93659 WP_003898661.1.93677 WP_003898661.1.9368 WP_003898661.1.93689 WP_003898661.1.93693 WP_003898661.1.93698 WP_003898661.1.93706 WP_003898661.1.9371 WP_003898661.1.93792 WP_003898661.1.93823 WP_003898661.1.93871 WP_003898661.1.9388 WP_003898661.1.93894 WP_003898661.1.93903 WP_003898661.1.93907 WP_003898661.1.93913 WP_003898661.1.93946 WP_003898661.1.93950 WP_003898661.1.93953 WP_003898661.1.93954 WP_003898661.1.93988 WP_003898661.1.9407 WP_003898661.1.94143 WP_003898661.1.94154 WP_003898661.1.94184 WP_003898661.1.94204 WP_003898661.1.94205 WP_003898661.1.94226 WP_003898661.1.94231 WP_003898661.1.94256 WP_003898661.1.94261 WP_003898661.1.94281 WP_003898661.1.94292 WP_003898661.1.94297 WP_003898661.1.9431 WP_003898661.1.94326 WP_003898661.1.94339 WP_003898661.1.94392 WP_003898661.1.94416 WP_003898661.1.94421 WP_003898661.1.94456 WP_003898661.1.94470 WP_003898661.1.94480 WP_003898661.1.94495 WP_003898661.1.94511 WP_003898661.1.94512 WP_003898661.1.94525 WP_003898661.1.94528 WP_003898661.1.94564 WP_003898661.1.946 WP_003898661.1.94623 WP_003898661.1.94629 WP_003898661.1.9465 WP_003898661.1.94673 WP_003898661.1.94730 WP_003898661.1.94736 WP_003898661.1.94776 WP_003898661.1.9478 WP_003898661.1.94834 WP_003898661.1.94852 WP_003898661.1.94872 WP_003898661.1.9488 WP_003898661.1.94916 WP_003898661.1.94979 WP_003898661.1.94994 WP_003898661.1.94996 WP_003898661.1.94998 WP_003898661.1.95007 WP_003898661.1.95010 WP_003898661.1.95015 WP_003898661.1.95034 WP_003898661.1.95068 WP_003898661.1.95081 WP_003898661.1.9509 WP_003898661.1.95096 WP_003898661.1.95112 WP_003898661.1.95138 WP_003898661.1.9514 WP_003898661.1.95179 WP_003898661.1.95188 WP_003898661.1.95190 WP_003898661.1.95234 WP_003898661.1.95241 WP_003898661.1.95245 WP_003898661.1.95257 WP_003898661.1.95279 WP_003898661.1.9531 WP_003898661.1.95335 WP_003898661.1.95344 WP_003898661.1.9535 WP_003898661.1.95370 WP_003898661.1.95392 WP_003898661.1.95416 WP_003898661.1.95417 WP_003898661.1.95454 WP_003898661.1.95455 WP_003898661.1.95491 WP_003898661.1.95497 WP_003898661.1.95508 WP_003898661.1.95509 WP_003898661.1.95529 WP_003898661.1.95556 WP_003898661.1.95557 WP_003898661.1.95565 WP_003898661.1.95578 WP_003898661.1.95580 WP_003898661.1.95585 WP_003898661.1.95643 WP_003898661.1.95679 WP_003898661.1.95685 WP_003898661.1.957 WP_003898661.1.95724 WP_003898661.1.95727 WP_003898661.1.95730 WP_003898661.1.95735 WP_003898661.1.95758 WP_003898661.1.95772 WP_003898661.1.95797 WP_003898661.1.95839 WP_003898661.1.9585 WP_003898661.1.9590 WP_003898661.1.95902 WP_003898661.1.95908 WP_003898661.1.95924 WP_003898661.1.95926 WP_003898661.1.95953 WP_003898661.1.95958 WP_003898661.1.95964 WP_003898661.1.95973 WP_003898661.1.96006 WP_003898661.1.9602 WP_003898661.1.96036 WP_003898661.1.96062 WP_003898661.1.96065 WP_003898661.1.96098 WP_003898661.1.96146 WP_003898661.1.96166 WP_003898661.1.96171 WP_003898661.1.96182 WP_003898661.1.96204 WP_003898661.1.96230 WP_003898661.1.96235 WP_003898661.1.96242 WP_003898661.1.96245 WP_003898661.1.96254 WP_003898661.1.96259 WP_003898661.1.96286 WP_003898661.1.96313 WP_003898661.1.96318 WP_003898661.1.96360 WP_003898661.1.96373 WP_003898661.1.96456 WP_003898661.1.96486 WP_003898661.1.96560 WP_003898661.1.96569 WP_003898661.1.96573 WP_003898661.1.96575 WP_003898661.1.96576 WP_003898661.1.96611 WP_003898661.1.96621 WP_003898661.1.9667 WP_003898661.1.96681 WP_003898661.1.96726 WP_003898661.1.96733 WP_003898661.1.96742 WP_003898661.1.96754 WP_003898661.1.9678 WP_003898661.1.96832 WP_003898661.1.9685 WP_003898661.1.97008 WP_003898661.1.97009 WP_003898661.1.97084 WP_003898661.1.97096 WP_003898661.1.97099 WP_003898661.1.97108 WP_003898661.1.97113 WP_003898661.1.97122 WP_003898661.1.97127 WP_003898661.1.97129 WP_003898661.1.97136 WP_003898661.1.9716 WP_003898661.1.97176 WP_003898661.1.97222 WP_003898661.1.97237 WP_003898661.1.97242 WP_003898661.1.97270 WP_003898661.1.97283 WP_003898661.1.97296 WP_003898661.1.97321 WP_003898661.1.97325 WP_003898661.1.97330 WP_003898661.1.97366 WP_003898661.1.97376 WP_003898661.1.97380 WP_003898661.1.9739 WP_003898661.1.97462 WP_003898661.1.97517 WP_003898661.1.97519 WP_003898661.1.97535 WP_003898661.1.97540 WP_003898661.1.97545 WP_003898661.1.97546 WP_003898661.1.97550 WP_003898661.1.97577 WP_003898661.1.97584 WP_003898661.1.9759 WP_003898661.1.97591 WP_003898661.1.97596 WP_003898661.1.97609 WP_003898661.1.97618 WP_003898661.1.9763 WP_003898661.1.97669 WP_003898661.1.97673 WP_003898661.1.97700 WP_003898661.1.97701 WP_003898661.1.9773 WP_003898661.1.97730 WP_003898661.1.97740 WP_003898661.1.97751 WP_003898661.1.97754 WP_003898661.1.97797 WP_003898661.1.9782 WP_003898661.1.9784 WP_003898661.1.97888 WP_003898661.1.9790 WP_003898661.1.9795 WP_003898661.1.97951 WP_003898661.1.97958 WP_003898661.1.97966 WP_003898661.1.97977 WP_003898661.1.97979 WP_003898661.1.97995 WP_003898661.1.98018 WP_003898661.1.98034 WP_003898661.1.98052 WP_003898661.1.98071 WP_003898661.1.98072 WP_003898661.1.98113 WP_003898661.1.98114 WP_003898661.1.98128 WP_003898661.1.98188 WP_003898661.1.98189 WP_003898661.1.98213 WP_003898661.1.98225 WP_003898661.1.98291 WP_003898661.1.98335 WP_003898661.1.98350 WP_003898661.1.98395 WP_003898661.1.98412 WP_003898661.1.98441 WP_003898661.1.98443 WP_003898661.1.98462 WP_003898661.1.9848 WP_003898661.1.98482 WP_003898661.1.98486 WP_003898661.1.98488 WP_003898661.1.98503 WP_003898661.1.98516 WP_003898661.1.98536 WP_003898661.1.98541 WP_003898661.1.98566 WP_003898661.1.98576 WP_003898661.1.98590 WP_003898661.1.98594 WP_003898661.1.98599 WP_003898661.1.98629 WP_003898661.1.98645 WP_003898661.1.98646 WP_003898661.1.98649 WP_003898661.1.98656 WP_003898661.1.9867 WP_003898661.1.98674 WP_003898661.1.98697 WP_003898661.1.98701 WP_003898661.1.98739 WP_003898661.1.98749 WP_003898661.1.98765 WP_003898661.1.98770 WP_003898661.1.98777 WP_003898661.1.98778 WP_003898661.1.98802 WP_003898661.1.98838 WP_003898661.1.98906 WP_003898661.1.98935 WP_003898661.1.98948 WP_003898661.1.98953 WP_003898661.1.98984 WP_003898661.1.99000 WP_003898661.1.99023 WP_003898661.1.99030 WP_003898661.1.99037 WP_003898661.1.99055 WP_003898661.1.99062 WP_003898661.1.99086 WP_003898661.1.99115 WP_003898661.1.99161 WP_003898661.1.99176 WP_003898661.1.99205 WP_003898661.1.99211 WP_003898661.1.99216 WP_003898661.1.99222 WP_003898661.1.99251 WP_003898661.1.99269 WP_003898661.1.99294 WP_003898661.1.99312 WP_003898661.1.99315 WP_003898661.1.99316 WP_003898661.1.99322 WP_003898661.1.99328 WP_003898661.1.99365 WP_003898661.1.99368 WP_003898661.1.99379 WP_003898661.1.99396 WP_003898661.1.99419 WP_003898661.1.99438 WP_003898661.1.99460 WP_003898661.1.99468 WP_003898661.1.99473 WP_003898661.1.99513 WP_003898661.1.99529 WP_003898661.1.99548 WP_003898661.1.99572 WP_003898661.1.99575 WP_003898661.1.99578 WP_003898661.1.99605 WP_003898661.1.99609 WP_003898661.1.99617 WP_003898661.1.99635 WP_003898661.1.99650 WP_003898661.1.99672 WP_003898661.1.99701 WP_003898661.1.99711 WP_003898661.1.99716 WP_003898661.1.99740 WP_003898661.1.99745 WP_003898661.1.99749 WP_003898661.1.9976 WP_003898661.1.99798 WP_003898661.1.99817 WP_003898661.1.99832 WP_003898661.1.99847 WP_003898661.1.99852 WP_003898661.1.99886 WP_003898661.1.99897 WP_003898661.1.99899 WP_003898661.1.99915 WP_003898661.1.9993 WP_003898661.1.99982 WP_003898661.1.99991 gi|197739697|ref|YP_002161011.1| gi|339631018|ref|YP_004722660.1| gi|224989352|ref|YP_002644039.1| 233413.Mb0981 336982.TBFG_10974 410289.BCG_1010 419947.MRA_0963 478434.TBMG_03033 561275.JTY_0980 83331.MT0983 83332.Rv0956 gi|479054907|ref|YP_007350713.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]