SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479056534|ref|YP_007352340.1| from Mycobacterium tuberculosis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479056534|ref|YP_007352340.1|
Domain Number 1 Region: 117-295,419-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.89e-96
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000011
Further Details:      
 
Domain Number 2 Region: 292-414
Classification Level Classification E-value
Superfamily GAD domain-like 1.46e-33
Family GAD domain 0.00037
Further Details:      
 
Domain Number 3 Region: 5-109
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.35e-29
Family Anticodon-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479056534|ref|YP_007352340.1|
Sequence length 596
Comment putative ASPARTYL-TRNA SYNTHETASE ASPS (ASPARTATE-TRNA LIGASE) (ASPRS) (ASPARTIC ACID TRANSLASE) [Mycobacterium tuberculosis 7199-99]
Sequence
MFVLRSHAAGLLREGDAGQQVTLAGWVARRRDHGGVIFIDLRDASGIAQVVFRDPQDTEV
LAQAHRLRAEFCVSVAGVVEIRPEGNANPEIATGEIEVNATSLTVLGECAPLPFQLDEPA
GEELRLKYRYLDLRRDDPAAAIRLRSRVNAAARAVLARHDFVEIETPTITRSTPEGARDF
LVPARLHPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDMEM
SFVDAEDIIAISEEVLTELWALIGYRIPTPIPRIGYAEAMRRFGTDKPDLRFGLELVECT
DFFSDTTFRVFQAPYVGAVVMPGGASQPRRTLDGWQDWAKQRGHRGLAYVLVAEDGTLGG
PVAKNLTEAERTGLADHVGAKPGDCIFFSAGPVKSSRALLGAARVEIANRLGLIDPDAWA
FVWVVDPPLFEPADEATAAGEVAVGSGAWTAVHHAFTAPKPEWEDRIESDTGSVLADAYD
IVCNGHEIGGGSVRIHRRDIQERVFAVMGLDKAEAEEKFGFLLEAFMFGAPPHGGIAFGW
DRTTALLAGMDSIREVIAFPKTGGGVDPLTDAPAPITAQQRKESGIDAQPKRVQQA
Download sequence
Identical sequences A0A0H3LC53 A0A2C5SLH2 A5U5S2 I6Y9P7
gi|148662411|ref|YP_001283934.1| MytuD.00145.a gi|385991875|ref|YP_005910173.1| gi|253798347|ref|YP_003031348.1| NP_217088.1.84033 WP_003899382.1.100000 WP_003899382.1.100021 WP_003899382.1.100069 WP_003899382.1.100087 WP_003899382.1.10015 WP_003899382.1.100216 WP_003899382.1.10022 WP_003899382.1.100260 WP_003899382.1.100270 WP_003899382.1.100279 WP_003899382.1.100286 WP_003899382.1.100309 WP_003899382.1.100318 WP_003899382.1.100337 WP_003899382.1.100338 WP_003899382.1.10037 WP_003899382.1.100383 WP_003899382.1.100396 WP_003899382.1.1004 WP_003899382.1.100401 WP_003899382.1.100459 WP_003899382.1.100552 WP_003899382.1.100600 WP_003899382.1.100625 WP_003899382.1.10064 WP_003899382.1.100666 WP_003899382.1.100671 WP_003899382.1.100677 WP_003899382.1.100682 WP_003899382.1.100697 WP_003899382.1.100703 WP_003899382.1.100716 WP_003899382.1.100722 WP_003899382.1.100754 WP_003899382.1.100757 WP_003899382.1.100772 WP_003899382.1.1008 WP_003899382.1.100812 WP_003899382.1.100845 WP_003899382.1.100866 WP_003899382.1.10088 WP_003899382.1.100889 WP_003899382.1.10090 WP_003899382.1.100910 WP_003899382.1.100915 WP_003899382.1.100918 WP_003899382.1.100935 WP_003899382.1.100984 WP_003899382.1.100992 WP_003899382.1.100998 WP_003899382.1.101025 WP_003899382.1.101028 WP_003899382.1.10104 WP_003899382.1.101048 WP_003899382.1.101054 WP_003899382.1.101075 WP_003899382.1.101143 WP_003899382.1.10116 WP_003899382.1.10117 WP_003899382.1.10125 WP_003899382.1.101290 WP_003899382.1.101323 WP_003899382.1.101324 WP_003899382.1.101350 WP_003899382.1.101367 WP_003899382.1.101398 WP_003899382.1.101403 WP_003899382.1.101421 WP_003899382.1.101442 WP_003899382.1.10145 WP_003899382.1.101452 WP_003899382.1.101456 WP_003899382.1.101481 WP_003899382.1.101493 WP_003899382.1.101496 WP_003899382.1.101525 WP_003899382.1.101533 WP_003899382.1.101535 WP_003899382.1.101558 WP_003899382.1.10156 WP_003899382.1.101573 WP_003899382.1.101576 WP_003899382.1.10159 WP_003899382.1.101592 WP_003899382.1.101604 WP_003899382.1.101622 WP_003899382.1.101644 WP_003899382.1.101659 WP_003899382.1.101671 WP_003899382.1.101698 WP_003899382.1.10170 WP_003899382.1.101713 WP_003899382.1.101722 WP_003899382.1.101733 WP_003899382.1.101743 WP_003899382.1.101753 WP_003899382.1.101754 WP_003899382.1.101764 WP_003899382.1.101795 WP_003899382.1.101798 WP_003899382.1.101802 WP_003899382.1.101826 WP_003899382.1.101836 WP_003899382.1.101858 WP_003899382.1.101859 WP_003899382.1.101862 WP_003899382.1.101888 WP_003899382.1.101894 WP_003899382.1.101899 WP_003899382.1.1019 WP_003899382.1.101923 WP_003899382.1.101925 WP_003899382.1.10193 WP_003899382.1.102 WP_003899382.1.102008 WP_003899382.1.102017 WP_003899382.1.102053 WP_003899382.1.102055 WP_003899382.1.102063 WP_003899382.1.102099 WP_003899382.1.1021 WP_003899382.1.10211 WP_003899382.1.102119 WP_003899382.1.102121 WP_003899382.1.102143 WP_003899382.1.10216 WP_003899382.1.10224 WP_003899382.1.10253 WP_003899382.1.10272 WP_003899382.1.10277 WP_003899382.1.1033 WP_003899382.1.10350 WP_003899382.1.10362 WP_003899382.1.10366 WP_003899382.1.10376 WP_003899382.1.10396 WP_003899382.1.10410 WP_003899382.1.10414 WP_003899382.1.10421 WP_003899382.1.1044 WP_003899382.1.10440 WP_003899382.1.10445 WP_003899382.1.10471 WP_003899382.1.10472 WP_003899382.1.10489 WP_003899382.1.105 WP_003899382.1.10518 WP_003899382.1.10523 WP_003899382.1.10545 WP_003899382.1.1057 WP_003899382.1.10594 WP_003899382.1.10603 WP_003899382.1.10606 WP_003899382.1.10615 WP_003899382.1.10623 WP_003899382.1.10635 WP_003899382.1.10643 WP_003899382.1.10648 WP_003899382.1.10662 WP_003899382.1.10735 WP_003899382.1.10740 WP_003899382.1.10756 WP_003899382.1.1078 WP_003899382.1.10791 WP_003899382.1.10799 WP_003899382.1.10848 WP_003899382.1.10863 WP_003899382.1.10912 WP_003899382.1.10916 WP_003899382.1.10923 WP_003899382.1.10927 WP_003899382.1.1095 WP_003899382.1.10956 WP_003899382.1.10958 WP_003899382.1.10962 WP_003899382.1.10981 WP_003899382.1.10993 WP_003899382.1.1100 WP_003899382.1.11040 WP_003899382.1.11061 WP_003899382.1.11070 WP_003899382.1.11141 WP_003899382.1.11171 WP_003899382.1.11175 WP_003899382.1.11176 WP_003899382.1.11236 WP_003899382.1.11329 WP_003899382.1.1133 WP_003899382.1.11342 WP_003899382.1.11373 WP_003899382.1.11376 WP_003899382.1.11390 WP_003899382.1.11402 WP_003899382.1.11481 WP_003899382.1.11487 WP_003899382.1.11489 WP_003899382.1.11491 WP_003899382.1.11514 WP_003899382.1.11589 WP_003899382.1.11596 WP_003899382.1.11604 WP_003899382.1.11610 WP_003899382.1.11697 WP_003899382.1.11707 WP_003899382.1.11752 WP_003899382.1.11758 WP_003899382.1.11761 WP_003899382.1.11775 WP_003899382.1.11804 WP_003899382.1.11822 WP_003899382.1.11826 WP_003899382.1.11856 WP_003899382.1.11898 WP_003899382.1.11906 WP_003899382.1.11939 WP_003899382.1.11960 WP_003899382.1.11961 WP_003899382.1.11972 WP_003899382.1.11984 WP_003899382.1.120 WP_003899382.1.12001 WP_003899382.1.12049 WP_003899382.1.12052 WP_003899382.1.12100 WP_003899382.1.12116 WP_003899382.1.12130 WP_003899382.1.12133 WP_003899382.1.12161 WP_003899382.1.12165 WP_003899382.1.12184 WP_003899382.1.12190 WP_003899382.1.12216 WP_003899382.1.12265 WP_003899382.1.12275 WP_003899382.1.12293 WP_003899382.1.12294 WP_003899382.1.123 WP_003899382.1.12314 WP_003899382.1.12327 WP_003899382.1.12338 WP_003899382.1.1236 WP_003899382.1.12371 WP_003899382.1.12372 WP_003899382.1.12389 WP_003899382.1.12406 WP_003899382.1.1241 WP_003899382.1.12421 WP_003899382.1.12424 WP_003899382.1.12464 WP_003899382.1.12479 WP_003899382.1.12519 WP_003899382.1.12523 WP_003899382.1.12526 WP_003899382.1.1255 WP_003899382.1.12550 WP_003899382.1.12551 WP_003899382.1.12563 WP_003899382.1.12611 WP_003899382.1.12669 WP_003899382.1.1267 WP_003899382.1.12672 WP_003899382.1.12692 WP_003899382.1.1271 WP_003899382.1.12768 WP_003899382.1.1279 WP_003899382.1.12794 WP_003899382.1.12804 WP_003899382.1.12821 WP_003899382.1.12841 WP_003899382.1.12854 WP_003899382.1.12871 WP_003899382.1.12901 WP_003899382.1.12941 WP_003899382.1.12947 WP_003899382.1.12957 WP_003899382.1.12972 WP_003899382.1.13028 WP_003899382.1.13043 WP_003899382.1.13086 WP_003899382.1.13087 WP_003899382.1.13090 WP_003899382.1.13096 WP_003899382.1.13163 WP_003899382.1.13175 WP_003899382.1.13183 WP_003899382.1.132 WP_003899382.1.13249 WP_003899382.1.13282 WP_003899382.1.13284 WP_003899382.1.13296 WP_003899382.1.13298 WP_003899382.1.13302 WP_003899382.1.13306 WP_003899382.1.13313 WP_003899382.1.13321 WP_003899382.1.13345 WP_003899382.1.13370 WP_003899382.1.13375 WP_003899382.1.1338 WP_003899382.1.13420 WP_003899382.1.13435 WP_003899382.1.13438 WP_003899382.1.13461 WP_003899382.1.13466 WP_003899382.1.13489 WP_003899382.1.13526 WP_003899382.1.13551 WP_003899382.1.13561 WP_003899382.1.13579 WP_003899382.1.13647 WP_003899382.1.13687 WP_003899382.1.13719 WP_003899382.1.13763 WP_003899382.1.1377 WP_003899382.1.13774 WP_003899382.1.13786 WP_003899382.1.13793 WP_003899382.1.13794 WP_003899382.1.13817 WP_003899382.1.13834 WP_003899382.1.13866 WP_003899382.1.13899 WP_003899382.1.13909 WP_003899382.1.13910 WP_003899382.1.13919 WP_003899382.1.13920 WP_003899382.1.13952 WP_003899382.1.13953 WP_003899382.1.13962 WP_003899382.1.1398 WP_003899382.1.13988 WP_003899382.1.14027 WP_003899382.1.14046 WP_003899382.1.14115 WP_003899382.1.1415 WP_003899382.1.14152 WP_003899382.1.14158 WP_003899382.1.14162 WP_003899382.1.14175 WP_003899382.1.14178 WP_003899382.1.14194 WP_003899382.1.14195 WP_003899382.1.14208 WP_003899382.1.14238 WP_003899382.1.14266 WP_003899382.1.14273 WP_003899382.1.14303 WP_003899382.1.14306 WP_003899382.1.14307 WP_003899382.1.14310 WP_003899382.1.14341 WP_003899382.1.14382 WP_003899382.1.14428 WP_003899382.1.14441 WP_003899382.1.14469 WP_003899382.1.14477 WP_003899382.1.14504 WP_003899382.1.14514 WP_003899382.1.1452 WP_003899382.1.14527 WP_003899382.1.1454 WP_003899382.1.14544 WP_003899382.1.14548 WP_003899382.1.14551 WP_003899382.1.14561 WP_003899382.1.14573 WP_003899382.1.1462 WP_003899382.1.14667 WP_003899382.1.14668 WP_003899382.1.14675 WP_003899382.1.14694 WP_003899382.1.14695 WP_003899382.1.14709 WP_003899382.1.14783 WP_003899382.1.14865 WP_003899382.1.14872 WP_003899382.1.14905 WP_003899382.1.14926 WP_003899382.1.14951 WP_003899382.1.14955 WP_003899382.1.15003 WP_003899382.1.15009 WP_003899382.1.15028 WP_003899382.1.15040 WP_003899382.1.15052 WP_003899382.1.15065 WP_003899382.1.15072 WP_003899382.1.15089 WP_003899382.1.1509 WP_003899382.1.15126 WP_003899382.1.15131 WP_003899382.1.15187 WP_003899382.1.15196 WP_003899382.1.15210 WP_003899382.1.15217 WP_003899382.1.1523 WP_003899382.1.15238 WP_003899382.1.15253 WP_003899382.1.15267 WP_003899382.1.1527 WP_003899382.1.15292 WP_003899382.1.15302 WP_003899382.1.15322 WP_003899382.1.15365 WP_003899382.1.15372 WP_003899382.1.15386 WP_003899382.1.15387 WP_003899382.1.15442 WP_003899382.1.15447 WP_003899382.1.15449 WP_003899382.1.15477 WP_003899382.1.15481 WP_003899382.1.15492 WP_003899382.1.15511 WP_003899382.1.15558 WP_003899382.1.15599 WP_003899382.1.1560 WP_003899382.1.15611 WP_003899382.1.1563 WP_003899382.1.15633 WP_003899382.1.15643 WP_003899382.1.15755 WP_003899382.1.15763 WP_003899382.1.15774 WP_003899382.1.1578 WP_003899382.1.15780 WP_003899382.1.15834 WP_003899382.1.15842 WP_003899382.1.15848 WP_003899382.1.15853 WP_003899382.1.15870 WP_003899382.1.15877 WP_003899382.1.15893 WP_003899382.1.15896 WP_003899382.1.15926 WP_003899382.1.15933 WP_003899382.1.15946 WP_003899382.1.15973 WP_003899382.1.15993 WP_003899382.1.16009 WP_003899382.1.16025 WP_003899382.1.16043 WP_003899382.1.16055 WP_003899382.1.16066 WP_003899382.1.16077 WP_003899382.1.16108 WP_003899382.1.16110 WP_003899382.1.16130 WP_003899382.1.16139 WP_003899382.1.16141 WP_003899382.1.16143 WP_003899382.1.1630 WP_003899382.1.16318 WP_003899382.1.16327 WP_003899382.1.16334 WP_003899382.1.16341 WP_003899382.1.16374 WP_003899382.1.16384 WP_003899382.1.16386 WP_003899382.1.164 WP_003899382.1.1642 WP_003899382.1.16424 WP_003899382.1.16426 WP_003899382.1.16431 WP_003899382.1.16438 WP_003899382.1.1644 WP_003899382.1.16442 WP_003899382.1.16448 WP_003899382.1.16451 WP_003899382.1.16476 WP_003899382.1.16494 WP_003899382.1.1652 WP_003899382.1.16549 WP_003899382.1.16598 WP_003899382.1.16609 WP_003899382.1.16619 WP_003899382.1.16620 WP_003899382.1.16622 WP_003899382.1.1669 WP_003899382.1.16707 WP_003899382.1.16724 WP_003899382.1.16731 WP_003899382.1.1683 WP_003899382.1.16837 WP_003899382.1.16852 WP_003899382.1.16937 WP_003899382.1.16940 WP_003899382.1.16950 WP_003899382.1.16959 WP_003899382.1.16968 WP_003899382.1.1697 WP_003899382.1.16977 WP_003899382.1.16987 WP_003899382.1.17005 WP_003899382.1.17006 WP_003899382.1.17010 WP_003899382.1.17015 WP_003899382.1.17019 WP_003899382.1.17041 WP_003899382.1.17057 WP_003899382.1.17062 WP_003899382.1.1707 WP_003899382.1.17094 WP_003899382.1.17138 WP_003899382.1.17147 WP_003899382.1.17167 WP_003899382.1.17224 WP_003899382.1.17251 WP_003899382.1.17304 WP_003899382.1.17345 WP_003899382.1.17381 WP_003899382.1.17391 WP_003899382.1.17412 WP_003899382.1.1743 WP_003899382.1.17440 WP_003899382.1.17466 WP_003899382.1.17477 WP_003899382.1.17483 WP_003899382.1.17505 WP_003899382.1.17527 WP_003899382.1.17535 WP_003899382.1.17553 WP_003899382.1.17635 WP_003899382.1.17655 WP_003899382.1.17679 WP_003899382.1.17687 WP_003899382.1.17700 WP_003899382.1.17710 WP_003899382.1.17713 WP_003899382.1.17722 WP_003899382.1.17746 WP_003899382.1.17788 WP_003899382.1.17798 WP_003899382.1.17803 WP_003899382.1.17816 WP_003899382.1.17821 WP_003899382.1.17830 WP_003899382.1.17878 WP_003899382.1.1792 WP_003899382.1.17923 WP_003899382.1.1795 WP_003899382.1.17955 WP_003899382.1.17973 WP_003899382.1.18009 WP_003899382.1.18013 WP_003899382.1.18033 WP_003899382.1.18057 WP_003899382.1.18065 WP_003899382.1.18070 WP_003899382.1.18116 WP_003899382.1.18120 WP_003899382.1.18126 WP_003899382.1.1817 WP_003899382.1.18170 WP_003899382.1.18206 WP_003899382.1.18216 WP_003899382.1.18240 WP_003899382.1.18257 WP_003899382.1.18297 WP_003899382.1.18306 WP_003899382.1.18364 WP_003899382.1.18399 WP_003899382.1.18411 WP_003899382.1.18444 WP_003899382.1.18448 WP_003899382.1.18467 WP_003899382.1.18476 WP_003899382.1.18522 WP_003899382.1.18580 WP_003899382.1.18582 WP_003899382.1.18587 WP_003899382.1.186 WP_003899382.1.18601 WP_003899382.1.18639 WP_003899382.1.18646 WP_003899382.1.18647 WP_003899382.1.1868 WP_003899382.1.18694 WP_003899382.1.18710 WP_003899382.1.18751 WP_003899382.1.18793 WP_003899382.1.18816 WP_003899382.1.18823 WP_003899382.1.18827 WP_003899382.1.18838 WP_003899382.1.18849 WP_003899382.1.18945 WP_003899382.1.1898 WP_003899382.1.19005 WP_003899382.1.19056 WP_003899382.1.19063 WP_003899382.1.19066 WP_003899382.1.19071 WP_003899382.1.19085 WP_003899382.1.19094 WP_003899382.1.19144 WP_003899382.1.19159 WP_003899382.1.19193 WP_003899382.1.19231 WP_003899382.1.19264 WP_003899382.1.19295 WP_003899382.1.19307 WP_003899382.1.1933 WP_003899382.1.19364 WP_003899382.1.19382 WP_003899382.1.19426 WP_003899382.1.19429 WP_003899382.1.19464 WP_003899382.1.19480 WP_003899382.1.19512 WP_003899382.1.19553 WP_003899382.1.19562 WP_003899382.1.19568 WP_003899382.1.19572 WP_003899382.1.19595 WP_003899382.1.19596 WP_003899382.1.19600 WP_003899382.1.19630 WP_003899382.1.1967 WP_003899382.1.19694 WP_003899382.1.1970 WP_003899382.1.19707 WP_003899382.1.19742 WP_003899382.1.19785 WP_003899382.1.19820 WP_003899382.1.19868 WP_003899382.1.19874 WP_003899382.1.19890 WP_003899382.1.19900 WP_003899382.1.19922 WP_003899382.1.19936 WP_003899382.1.19946 WP_003899382.1.19960 WP_003899382.1.20007 WP_003899382.1.20016 WP_003899382.1.20028 WP_003899382.1.2003 WP_003899382.1.20037 WP_003899382.1.20039 WP_003899382.1.20082 WP_003899382.1.20085 WP_003899382.1.20097 WP_003899382.1.20116 WP_003899382.1.20140 WP_003899382.1.20141 WP_003899382.1.20142 WP_003899382.1.20158 WP_003899382.1.20239 WP_003899382.1.20243 WP_003899382.1.20262 WP_003899382.1.20268 WP_003899382.1.20272 WP_003899382.1.20273 WP_003899382.1.20280 WP_003899382.1.20294 WP_003899382.1.20300 WP_003899382.1.20322 WP_003899382.1.2037 WP_003899382.1.20372 WP_003899382.1.20381 WP_003899382.1.204 WP_003899382.1.20427 WP_003899382.1.20432 WP_003899382.1.20457 WP_003899382.1.20459 WP_003899382.1.20460 WP_003899382.1.20542 WP_003899382.1.20608 WP_003899382.1.20624 WP_003899382.1.20628 WP_003899382.1.20707 WP_003899382.1.20722 WP_003899382.1.20729 WP_003899382.1.20742 WP_003899382.1.20751 WP_003899382.1.20776 WP_003899382.1.20843 WP_003899382.1.2086 WP_003899382.1.20868 WP_003899382.1.20876 WP_003899382.1.20897 WP_003899382.1.20898 WP_003899382.1.2090 WP_003899382.1.20911 WP_003899382.1.20916 WP_003899382.1.20921 WP_003899382.1.20926 WP_003899382.1.20927 WP_003899382.1.20951 WP_003899382.1.20970 WP_003899382.1.2104 WP_003899382.1.21127 WP_003899382.1.21135 WP_003899382.1.21173 WP_003899382.1.21187 WP_003899382.1.212 WP_003899382.1.2120 WP_003899382.1.21218 WP_003899382.1.21219 WP_003899382.1.2123 WP_003899382.1.21234 WP_003899382.1.2126 WP_003899382.1.21292 WP_003899382.1.21307 WP_003899382.1.2131 WP_003899382.1.21311 WP_003899382.1.21321 WP_003899382.1.21365 WP_003899382.1.2137 WP_003899382.1.21392 WP_003899382.1.21397 WP_003899382.1.21403 WP_003899382.1.21415 WP_003899382.1.21418 WP_003899382.1.21430 WP_003899382.1.21434 WP_003899382.1.21444 WP_003899382.1.21468 WP_003899382.1.21498 WP_003899382.1.21509 WP_003899382.1.21513 WP_003899382.1.21560 WP_003899382.1.21565 WP_003899382.1.21586 WP_003899382.1.21591 WP_003899382.1.21594 WP_003899382.1.21615 WP_003899382.1.21638 WP_003899382.1.21639 WP_003899382.1.21655 WP_003899382.1.21658 WP_003899382.1.2168 WP_003899382.1.2174 WP_003899382.1.21741 WP_003899382.1.21777 WP_003899382.1.21786 WP_003899382.1.21795 WP_003899382.1.218 WP_003899382.1.21826 WP_003899382.1.21829 WP_003899382.1.21840 WP_003899382.1.21843 WP_003899382.1.21872 WP_003899382.1.21873 WP_003899382.1.2188 WP_003899382.1.21882 WP_003899382.1.21906 WP_003899382.1.21912 WP_003899382.1.21941 WP_003899382.1.21956 WP_003899382.1.21958 WP_003899382.1.21960 WP_003899382.1.21971 WP_003899382.1.21983 WP_003899382.1.22003 WP_003899382.1.22013 WP_003899382.1.22025 WP_003899382.1.22036 WP_003899382.1.22075 WP_003899382.1.22092 WP_003899382.1.2212 WP_003899382.1.22140 WP_003899382.1.22233 WP_003899382.1.22255 WP_003899382.1.22277 WP_003899382.1.22348 WP_003899382.1.22356 WP_003899382.1.22366 WP_003899382.1.2238 WP_003899382.1.22437 WP_003899382.1.22438 WP_003899382.1.22445 WP_003899382.1.22490 WP_003899382.1.22511 WP_003899382.1.22524 WP_003899382.1.22585 WP_003899382.1.22589 WP_003899382.1.22606 WP_003899382.1.22608 WP_003899382.1.22609 WP_003899382.1.22618 WP_003899382.1.2262 WP_003899382.1.22629 WP_003899382.1.22647 WP_003899382.1.22664 WP_003899382.1.22665 WP_003899382.1.22670 WP_003899382.1.22674 WP_003899382.1.22725 WP_003899382.1.22728 WP_003899382.1.22733 WP_003899382.1.2275 WP_003899382.1.22800 WP_003899382.1.22829 WP_003899382.1.22840 WP_003899382.1.22844 WP_003899382.1.22963 WP_003899382.1.22970 WP_003899382.1.22996 WP_003899382.1.22997 WP_003899382.1.22999 WP_003899382.1.23015 WP_003899382.1.23032 WP_003899382.1.231 WP_003899382.1.23101 WP_003899382.1.23153 WP_003899382.1.23171 WP_003899382.1.23199 WP_003899382.1.2320 WP_003899382.1.23204 WP_003899382.1.23216 WP_003899382.1.23233 WP_003899382.1.23261 WP_003899382.1.23272 WP_003899382.1.23289 WP_003899382.1.2329 WP_003899382.1.23316 WP_003899382.1.23321 WP_003899382.1.23325 WP_003899382.1.2339 WP_003899382.1.23406 WP_003899382.1.23438 WP_003899382.1.23445 WP_003899382.1.23447 WP_003899382.1.23452 WP_003899382.1.23461 WP_003899382.1.23496 WP_003899382.1.23506 WP_003899382.1.23530 WP_003899382.1.23539 WP_003899382.1.23546 WP_003899382.1.23551 WP_003899382.1.23573 WP_003899382.1.23583 WP_003899382.1.23588 WP_003899382.1.23628 WP_003899382.1.23677 WP_003899382.1.23683 WP_003899382.1.23692 WP_003899382.1.23699 WP_003899382.1.23803 WP_003899382.1.23807 WP_003899382.1.23825 WP_003899382.1.23832 WP_003899382.1.2384 WP_003899382.1.23843 WP_003899382.1.23863 WP_003899382.1.23894 WP_003899382.1.23993 WP_003899382.1.24007 WP_003899382.1.24008 WP_003899382.1.24046 WP_003899382.1.24057 WP_003899382.1.24113 WP_003899382.1.24119 WP_003899382.1.24128 WP_003899382.1.24140 WP_003899382.1.24202 WP_003899382.1.24261 WP_003899382.1.24284 WP_003899382.1.24294 WP_003899382.1.24396 WP_003899382.1.24414 WP_003899382.1.24423 WP_003899382.1.2443 WP_003899382.1.24446 WP_003899382.1.24461 WP_003899382.1.24500 WP_003899382.1.24507 WP_003899382.1.24509 WP_003899382.1.24553 WP_003899382.1.24629 WP_003899382.1.24638 WP_003899382.1.2466 WP_003899382.1.24824 WP_003899382.1.24831 WP_003899382.1.24840 WP_003899382.1.24848 WP_003899382.1.24857 WP_003899382.1.2487 WP_003899382.1.24893 WP_003899382.1.24907 WP_003899382.1.24956 WP_003899382.1.24958 WP_003899382.1.24985 WP_003899382.1.2499 WP_003899382.1.25004 WP_003899382.1.2505 WP_003899382.1.25051 WP_003899382.1.25096 WP_003899382.1.25103 WP_003899382.1.25129 WP_003899382.1.25171 WP_003899382.1.25184 WP_003899382.1.25247 WP_003899382.1.25252 WP_003899382.1.25278 WP_003899382.1.25283 WP_003899382.1.25309 WP_003899382.1.25313 WP_003899382.1.25338 WP_003899382.1.25342 WP_003899382.1.25343 WP_003899382.1.25393 WP_003899382.1.25406 WP_003899382.1.25435 WP_003899382.1.25437 WP_003899382.1.25445 WP_003899382.1.25455 WP_003899382.1.25473 WP_003899382.1.25504 WP_003899382.1.25513 WP_003899382.1.25542 WP_003899382.1.25579 WP_003899382.1.25594 WP_003899382.1.25606 WP_003899382.1.25645 WP_003899382.1.2566 WP_003899382.1.25674 WP_003899382.1.25693 WP_003899382.1.25699 WP_003899382.1.25727 WP_003899382.1.25736 WP_003899382.1.25738 WP_003899382.1.25756 WP_003899382.1.25759 WP_003899382.1.2580 WP_003899382.1.25813 WP_003899382.1.25853 WP_003899382.1.25854 WP_003899382.1.25874 WP_003899382.1.25885 WP_003899382.1.25892 WP_003899382.1.25906 WP_003899382.1.25914 WP_003899382.1.25916 WP_003899382.1.2594 WP_003899382.1.25954 WP_003899382.1.25972 WP_003899382.1.26017 WP_003899382.1.26032 WP_003899382.1.26038 WP_003899382.1.26072 WP_003899382.1.26089 WP_003899382.1.26097 WP_003899382.1.26098 WP_003899382.1.26108 WP_003899382.1.26126 WP_003899382.1.2614 WP_003899382.1.26168 WP_003899382.1.26182 WP_003899382.1.26190 WP_003899382.1.2620 WP_003899382.1.26234 WP_003899382.1.26243 WP_003899382.1.26267 WP_003899382.1.26292 WP_003899382.1.26310 WP_003899382.1.26349 WP_003899382.1.26366 WP_003899382.1.26374 WP_003899382.1.26407 WP_003899382.1.26454 WP_003899382.1.26464 WP_003899382.1.2653 WP_003899382.1.26560 WP_003899382.1.26571 WP_003899382.1.2659 WP_003899382.1.26597 WP_003899382.1.26603 WP_003899382.1.26629 WP_003899382.1.26651 WP_003899382.1.26702 WP_003899382.1.26707 WP_003899382.1.26710 WP_003899382.1.26737 WP_003899382.1.26738 WP_003899382.1.26745 WP_003899382.1.26756 WP_003899382.1.2677 WP_003899382.1.26779 WP_003899382.1.26780 WP_003899382.1.26798 WP_003899382.1.26854 WP_003899382.1.26876 WP_003899382.1.26888 WP_003899382.1.26914 WP_003899382.1.26945 WP_003899382.1.26959 WP_003899382.1.26969 WP_003899382.1.26984 WP_003899382.1.26992 WP_003899382.1.27004 WP_003899382.1.27017 WP_003899382.1.27045 WP_003899382.1.27074 WP_003899382.1.27075 WP_003899382.1.27128 WP_003899382.1.27130 WP_003899382.1.27139 WP_003899382.1.27152 WP_003899382.1.27162 WP_003899382.1.27164 WP_003899382.1.27193 WP_003899382.1.27235 WP_003899382.1.27278 WP_003899382.1.27343 WP_003899382.1.27352 WP_003899382.1.27369 WP_003899382.1.27391 WP_003899382.1.27398 WP_003899382.1.27410 WP_003899382.1.27411 WP_003899382.1.27449 WP_003899382.1.27460 WP_003899382.1.27463 WP_003899382.1.27492 WP_003899382.1.27528 WP_003899382.1.27541 WP_003899382.1.27576 WP_003899382.1.27582 WP_003899382.1.27596 WP_003899382.1.27607 WP_003899382.1.2766 WP_003899382.1.277 WP_003899382.1.27724 WP_003899382.1.27730 WP_003899382.1.27736 WP_003899382.1.27743 WP_003899382.1.27750 WP_003899382.1.27771 WP_003899382.1.27779 WP_003899382.1.27795 WP_003899382.1.27803 WP_003899382.1.27819 WP_003899382.1.27835 WP_003899382.1.27915 WP_003899382.1.27935 WP_003899382.1.27962 WP_003899382.1.28053 WP_003899382.1.28092 WP_003899382.1.28106 WP_003899382.1.28159 WP_003899382.1.2816 WP_003899382.1.28161 WP_003899382.1.28192 WP_003899382.1.28202 WP_003899382.1.28241 WP_003899382.1.28242 WP_003899382.1.28251 WP_003899382.1.28255 WP_003899382.1.28269 WP_003899382.1.28276 WP_003899382.1.28293 WP_003899382.1.28331 WP_003899382.1.28378 WP_003899382.1.2842 WP_003899382.1.28448 WP_003899382.1.28471 WP_003899382.1.28473 WP_003899382.1.28493 WP_003899382.1.28497 WP_003899382.1.28530 WP_003899382.1.28545 WP_003899382.1.28561 WP_003899382.1.28567 WP_003899382.1.28585 WP_003899382.1.286 WP_003899382.1.28610 WP_003899382.1.28617 WP_003899382.1.28634 WP_003899382.1.28642 WP_003899382.1.28671 WP_003899382.1.28682 WP_003899382.1.28698 WP_003899382.1.28703 WP_003899382.1.28739 WP_003899382.1.28758 WP_003899382.1.28781 WP_003899382.1.28787 WP_003899382.1.28827 WP_003899382.1.28839 WP_003899382.1.28847 WP_003899382.1.28850 WP_003899382.1.28851 WP_003899382.1.28897 WP_003899382.1.28914 WP_003899382.1.28935 WP_003899382.1.28936 WP_003899382.1.28939 WP_003899382.1.28943 WP_003899382.1.28952 WP_003899382.1.28975 WP_003899382.1.2899 WP_003899382.1.28993 WP_003899382.1.29000 WP_003899382.1.2901 WP_003899382.1.29028 WP_003899382.1.29033 WP_003899382.1.29058 WP_003899382.1.29078 WP_003899382.1.29102 WP_003899382.1.29217 WP_003899382.1.29223 WP_003899382.1.29264 WP_003899382.1.29275 WP_003899382.1.29306 WP_003899382.1.29339 WP_003899382.1.29348 WP_003899382.1.29364 WP_003899382.1.29367 WP_003899382.1.29399 WP_003899382.1.29426 WP_003899382.1.2944 WP_003899382.1.29449 WP_003899382.1.29450 WP_003899382.1.29452 WP_003899382.1.2949 WP_003899382.1.29510 WP_003899382.1.29515 WP_003899382.1.29525 WP_003899382.1.2953 WP_003899382.1.29587 WP_003899382.1.2959 WP_003899382.1.29592 WP_003899382.1.29599 WP_003899382.1.29611 WP_003899382.1.29632 WP_003899382.1.29649 WP_003899382.1.2965 WP_003899382.1.29659 WP_003899382.1.2969 WP_003899382.1.29696 WP_003899382.1.29698 WP_003899382.1.29742 WP_003899382.1.29745 WP_003899382.1.29747 WP_003899382.1.29769 WP_003899382.1.29825 WP_003899382.1.29830 WP_003899382.1.29861 WP_003899382.1.29869 WP_003899382.1.29883 WP_003899382.1.29890 WP_003899382.1.299 WP_003899382.1.29931 WP_003899382.1.29960 WP_003899382.1.30014 WP_003899382.1.3004 WP_003899382.1.30040 WP_003899382.1.30043 WP_003899382.1.30074 WP_003899382.1.30097 WP_003899382.1.30101 WP_003899382.1.30106 WP_003899382.1.30114 WP_003899382.1.30126 WP_003899382.1.30131 WP_003899382.1.30138 WP_003899382.1.30139 WP_003899382.1.30145 WP_003899382.1.30224 WP_003899382.1.3027 WP_003899382.1.30279 WP_003899382.1.30282 WP_003899382.1.30283 WP_003899382.1.30288 WP_003899382.1.30291 WP_003899382.1.30363 WP_003899382.1.30374 WP_003899382.1.30404 WP_003899382.1.30433 WP_003899382.1.30438 WP_003899382.1.30462 WP_003899382.1.30464 WP_003899382.1.30468 WP_003899382.1.30500 WP_003899382.1.3057 WP_003899382.1.30574 WP_003899382.1.30628 WP_003899382.1.30641 WP_003899382.1.30642 WP_003899382.1.30661 WP_003899382.1.30683 WP_003899382.1.30699 WP_003899382.1.30709 WP_003899382.1.30713 WP_003899382.1.30719 WP_003899382.1.30730 WP_003899382.1.30736 WP_003899382.1.30745 WP_003899382.1.30791 WP_003899382.1.308 WP_003899382.1.30807 WP_003899382.1.30818 WP_003899382.1.30824 WP_003899382.1.30848 WP_003899382.1.30877 WP_003899382.1.30888 WP_003899382.1.30901 WP_003899382.1.30903 WP_003899382.1.30912 WP_003899382.1.30913 WP_003899382.1.30914 WP_003899382.1.30919 WP_003899382.1.30977 WP_003899382.1.3100 WP_003899382.1.3101 WP_003899382.1.31034 WP_003899382.1.31047 WP_003899382.1.31070 WP_003899382.1.31074 WP_003899382.1.31127 WP_003899382.1.31184 WP_003899382.1.31199 WP_003899382.1.31226 WP_003899382.1.31230 WP_003899382.1.31233 WP_003899382.1.31264 WP_003899382.1.31270 WP_003899382.1.31287 WP_003899382.1.31290 WP_003899382.1.31304 WP_003899382.1.31346 WP_003899382.1.31348 WP_003899382.1.31354 WP_003899382.1.31417 WP_003899382.1.31428 WP_003899382.1.3143 WP_003899382.1.31458 WP_003899382.1.3149 WP_003899382.1.31498 WP_003899382.1.31507 WP_003899382.1.31537 WP_003899382.1.31548 WP_003899382.1.31569 WP_003899382.1.31573 WP_003899382.1.316 WP_003899382.1.31629 WP_003899382.1.31666 WP_003899382.1.31693 WP_003899382.1.31703 WP_003899382.1.31770 WP_003899382.1.31776 WP_003899382.1.31783 WP_003899382.1.318 WP_003899382.1.3184 WP_003899382.1.31840 WP_003899382.1.31880 WP_003899382.1.31911 WP_003899382.1.31932 WP_003899382.1.31955 WP_003899382.1.31985 WP_003899382.1.31991 WP_003899382.1.31995 WP_003899382.1.32004 WP_003899382.1.3204 WP_003899382.1.32045 WP_003899382.1.32071 WP_003899382.1.32098 WP_003899382.1.32132 WP_003899382.1.32157 WP_003899382.1.32164 WP_003899382.1.32179 WP_003899382.1.32198 WP_003899382.1.32297 WP_003899382.1.32317 WP_003899382.1.32383 WP_003899382.1.32400 WP_003899382.1.32403 WP_003899382.1.32416 WP_003899382.1.32421 WP_003899382.1.32461 WP_003899382.1.32482 WP_003899382.1.32503 WP_003899382.1.32562 WP_003899382.1.32569 WP_003899382.1.32592 WP_003899382.1.32620 WP_003899382.1.32647 WP_003899382.1.32653 WP_003899382.1.32654 WP_003899382.1.3268 WP_003899382.1.32695 WP_003899382.1.32706 WP_003899382.1.32716 WP_003899382.1.32738 WP_003899382.1.32752 WP_003899382.1.32780 WP_003899382.1.32781 WP_003899382.1.32793 WP_003899382.1.32799 WP_003899382.1.32833 WP_003899382.1.32862 WP_003899382.1.32880 WP_003899382.1.32897 WP_003899382.1.32909 WP_003899382.1.32935 WP_003899382.1.32974 WP_003899382.1.33007 WP_003899382.1.3302 WP_003899382.1.33028 WP_003899382.1.33035 WP_003899382.1.33044 WP_003899382.1.33054 WP_003899382.1.33082 WP_003899382.1.33141 WP_003899382.1.33148 WP_003899382.1.33155 WP_003899382.1.33168 WP_003899382.1.3321 WP_003899382.1.33215 WP_003899382.1.3325 WP_003899382.1.3327 WP_003899382.1.33278 WP_003899382.1.33288 WP_003899382.1.33305 WP_003899382.1.3331 WP_003899382.1.33319 WP_003899382.1.3333 WP_003899382.1.33393 WP_003899382.1.33403 WP_003899382.1.33452 WP_003899382.1.33467 WP_003899382.1.3349 WP_003899382.1.33519 WP_003899382.1.33542 WP_003899382.1.33601 WP_003899382.1.33602 WP_003899382.1.33633 WP_003899382.1.33646 WP_003899382.1.33673 WP_003899382.1.3369 WP_003899382.1.33705 WP_003899382.1.33762 WP_003899382.1.33783 WP_003899382.1.33789 WP_003899382.1.3383 WP_003899382.1.33832 WP_003899382.1.33848 WP_003899382.1.3387 WP_003899382.1.33886 WP_003899382.1.33906 WP_003899382.1.33912 WP_003899382.1.33954 WP_003899382.1.3399 WP_003899382.1.34042 WP_003899382.1.3405 WP_003899382.1.34055 WP_003899382.1.34056 WP_003899382.1.34065 WP_003899382.1.3408 WP_003899382.1.34090 WP_003899382.1.34109 WP_003899382.1.34131 WP_003899382.1.34152 WP_003899382.1.34153 WP_003899382.1.34163 WP_003899382.1.34181 WP_003899382.1.34197 WP_003899382.1.34219 WP_003899382.1.34255 WP_003899382.1.34260 WP_003899382.1.34275 WP_003899382.1.343 WP_003899382.1.34347 WP_003899382.1.34392 WP_003899382.1.344 WP_003899382.1.34428 WP_003899382.1.3443 WP_003899382.1.34435 WP_003899382.1.34446 WP_003899382.1.34499 WP_003899382.1.34505 WP_003899382.1.34516 WP_003899382.1.34529 WP_003899382.1.34551 WP_003899382.1.34563 WP_003899382.1.34576 WP_003899382.1.34581 WP_003899382.1.34588 WP_003899382.1.34596 WP_003899382.1.34599 WP_003899382.1.34639 WP_003899382.1.34673 WP_003899382.1.34724 WP_003899382.1.34740 WP_003899382.1.34755 WP_003899382.1.34777 WP_003899382.1.34783 WP_003899382.1.34841 WP_003899382.1.34908 WP_003899382.1.34919 WP_003899382.1.3492 WP_003899382.1.34933 WP_003899382.1.34945 WP_003899382.1.34946 WP_003899382.1.34954 WP_003899382.1.34960 WP_003899382.1.34961 WP_003899382.1.34963 WP_003899382.1.34968 WP_003899382.1.35023 WP_003899382.1.35069 WP_003899382.1.35072 WP_003899382.1.35078 WP_003899382.1.35146 WP_003899382.1.35156 WP_003899382.1.35160 WP_003899382.1.35162 WP_003899382.1.35176 WP_003899382.1.3520 WP_003899382.1.35246 WP_003899382.1.35278 WP_003899382.1.35301 WP_003899382.1.35311 WP_003899382.1.35312 WP_003899382.1.35317 WP_003899382.1.35319 WP_003899382.1.35347 WP_003899382.1.35363 WP_003899382.1.35385 WP_003899382.1.35396 WP_003899382.1.35397 WP_003899382.1.35426 WP_003899382.1.35439 WP_003899382.1.35455 WP_003899382.1.3548 WP_003899382.1.35484 WP_003899382.1.35492 WP_003899382.1.3553 WP_003899382.1.35555 WP_003899382.1.35561 WP_003899382.1.35602 WP_003899382.1.35610 WP_003899382.1.35635 WP_003899382.1.35657 WP_003899382.1.35687 WP_003899382.1.35689 WP_003899382.1.35707 WP_003899382.1.35732 WP_003899382.1.35754 WP_003899382.1.35767 WP_003899382.1.35770 WP_003899382.1.35771 WP_003899382.1.35780 WP_003899382.1.35805 WP_003899382.1.35811 WP_003899382.1.35821 WP_003899382.1.3584 WP_003899382.1.35848 WP_003899382.1.35864 WP_003899382.1.35874 WP_003899382.1.35876 WP_003899382.1.35897 WP_003899382.1.35899 WP_003899382.1.35923 WP_003899382.1.3593 WP_003899382.1.36005 WP_003899382.1.36014 WP_003899382.1.36023 WP_003899382.1.36051 WP_003899382.1.36089 WP_003899382.1.36097 WP_003899382.1.36098 WP_003899382.1.36145 WP_003899382.1.36156 WP_003899382.1.36205 WP_003899382.1.36228 WP_003899382.1.36252 WP_003899382.1.36260 WP_003899382.1.36270 WP_003899382.1.36271 WP_003899382.1.36303 WP_003899382.1.36309 WP_003899382.1.36315 WP_003899382.1.36319 WP_003899382.1.36321 WP_003899382.1.36326 WP_003899382.1.3634 WP_003899382.1.36357 WP_003899382.1.3636 WP_003899382.1.36385 WP_003899382.1.36399 WP_003899382.1.36436 WP_003899382.1.36465 WP_003899382.1.36469 WP_003899382.1.36473 WP_003899382.1.36485 WP_003899382.1.36508 WP_003899382.1.36540 WP_003899382.1.36561 WP_003899382.1.36571 WP_003899382.1.36573 WP_003899382.1.36578 WP_003899382.1.36585 WP_003899382.1.36597 WP_003899382.1.36614 WP_003899382.1.36674 WP_003899382.1.36720 WP_003899382.1.36785 WP_003899382.1.36810 WP_003899382.1.36844 WP_003899382.1.36851 WP_003899382.1.36862 WP_003899382.1.36901 WP_003899382.1.36921 WP_003899382.1.36935 WP_003899382.1.36941 WP_003899382.1.3695 WP_003899382.1.36951 WP_003899382.1.36968 WP_003899382.1.37004 WP_003899382.1.37012 WP_003899382.1.37071 WP_003899382.1.37088 WP_003899382.1.37131 WP_003899382.1.37157 WP_003899382.1.37175 WP_003899382.1.37188 WP_003899382.1.37213 WP_003899382.1.37229 WP_003899382.1.3724 WP_003899382.1.37277 WP_003899382.1.37305 WP_003899382.1.37330 WP_003899382.1.37389 WP_003899382.1.37400 WP_003899382.1.37440 WP_003899382.1.37459 WP_003899382.1.37468 WP_003899382.1.37601 WP_003899382.1.37612 WP_003899382.1.37632 WP_003899382.1.37643 WP_003899382.1.37655 WP_003899382.1.37660 WP_003899382.1.37674 WP_003899382.1.37700 WP_003899382.1.37701 WP_003899382.1.37711 WP_003899382.1.37722 WP_003899382.1.37747 WP_003899382.1.37765 WP_003899382.1.37772 WP_003899382.1.37804 WP_003899382.1.37809 WP_003899382.1.37859 WP_003899382.1.37877 WP_003899382.1.37913 WP_003899382.1.37943 WP_003899382.1.37950 WP_003899382.1.37983 WP_003899382.1.38 WP_003899382.1.38002 WP_003899382.1.3802 WP_003899382.1.38039 WP_003899382.1.38040 WP_003899382.1.38067 WP_003899382.1.38068 WP_003899382.1.38138 WP_003899382.1.38144 WP_003899382.1.38159 WP_003899382.1.38210 WP_003899382.1.38233 WP_003899382.1.38240 WP_003899382.1.38299 WP_003899382.1.38332 WP_003899382.1.38347 WP_003899382.1.38354 WP_003899382.1.38380 WP_003899382.1.38384 WP_003899382.1.38389 WP_003899382.1.38398 WP_003899382.1.38402 WP_003899382.1.38418 WP_003899382.1.38466 WP_003899382.1.38483 WP_003899382.1.3849 WP_003899382.1.38530 WP_003899382.1.38535 WP_003899382.1.38539 WP_003899382.1.38594 WP_003899382.1.38611 WP_003899382.1.38638 WP_003899382.1.38639 WP_003899382.1.38646 WP_003899382.1.38648 WP_003899382.1.38654 WP_003899382.1.38659 WP_003899382.1.38666 WP_003899382.1.38671 WP_003899382.1.38672 WP_003899382.1.38677 WP_003899382.1.38750 WP_003899382.1.38772 WP_003899382.1.38812 WP_003899382.1.38821 WP_003899382.1.38844 WP_003899382.1.38863 WP_003899382.1.38865 WP_003899382.1.38873 WP_003899382.1.3889 WP_003899382.1.38894 WP_003899382.1.38909 WP_003899382.1.38939 WP_003899382.1.38974 WP_003899382.1.38991 WP_003899382.1.39025 WP_003899382.1.39070 WP_003899382.1.39072 WP_003899382.1.39095 WP_003899382.1.39106 WP_003899382.1.39165 WP_003899382.1.39174 WP_003899382.1.39176 WP_003899382.1.39178 WP_003899382.1.39201 WP_003899382.1.39207 WP_003899382.1.39211 WP_003899382.1.39236 WP_003899382.1.39239 WP_003899382.1.39252 WP_003899382.1.39359 WP_003899382.1.39364 WP_003899382.1.39400 WP_003899382.1.39447 WP_003899382.1.3945 WP_003899382.1.39450 WP_003899382.1.39455 WP_003899382.1.39560 WP_003899382.1.39592 WP_003899382.1.396 WP_003899382.1.3960 WP_003899382.1.39616 WP_003899382.1.39654 WP_003899382.1.39657 WP_003899382.1.39661 WP_003899382.1.39674 WP_003899382.1.39678 WP_003899382.1.3968 WP_003899382.1.39694 WP_003899382.1.3971 WP_003899382.1.39718 WP_003899382.1.39728 WP_003899382.1.39739 WP_003899382.1.39748 WP_003899382.1.39751 WP_003899382.1.39759 WP_003899382.1.39801 WP_003899382.1.39804 WP_003899382.1.39877 WP_003899382.1.39925 WP_003899382.1.3994 WP_003899382.1.39959 WP_003899382.1.3996 WP_003899382.1.39960 WP_003899382.1.3997 WP_003899382.1.39980 WP_003899382.1.40000 WP_003899382.1.40028 WP_003899382.1.40029 WP_003899382.1.4003 WP_003899382.1.40096 WP_003899382.1.40150 WP_003899382.1.40156 WP_003899382.1.40174 WP_003899382.1.40186 WP_003899382.1.40276 WP_003899382.1.40277 WP_003899382.1.40323 WP_003899382.1.40336 WP_003899382.1.40353 WP_003899382.1.4036 WP_003899382.1.40372 WP_003899382.1.40402 WP_003899382.1.40413 WP_003899382.1.40440 WP_003899382.1.40446 WP_003899382.1.40451 WP_003899382.1.40455 WP_003899382.1.40523 WP_003899382.1.40641 WP_003899382.1.40646 WP_003899382.1.40651 WP_003899382.1.40653 WP_003899382.1.4067 WP_003899382.1.40705 WP_003899382.1.40723 WP_003899382.1.40731 WP_003899382.1.40735 WP_003899382.1.40799 WP_003899382.1.40852 WP_003899382.1.40881 WP_003899382.1.40922 WP_003899382.1.40948 WP_003899382.1.4095 WP_003899382.1.40956 WP_003899382.1.40957 WP_003899382.1.40964 WP_003899382.1.4097 WP_003899382.1.41000 WP_003899382.1.41055 WP_003899382.1.41108 WP_003899382.1.41123 WP_003899382.1.41177 WP_003899382.1.41202 WP_003899382.1.41231 WP_003899382.1.41249 WP_003899382.1.41296 WP_003899382.1.41355 WP_003899382.1.41376 WP_003899382.1.41430 WP_003899382.1.41469 WP_003899382.1.41504 WP_003899382.1.41553 WP_003899382.1.41564 WP_003899382.1.41616 WP_003899382.1.41635 WP_003899382.1.41636 WP_003899382.1.41648 WP_003899382.1.41660 WP_003899382.1.41685 WP_003899382.1.41695 WP_003899382.1.41704 WP_003899382.1.4171 WP_003899382.1.41719 WP_003899382.1.41733 WP_003899382.1.41744 WP_003899382.1.41774 WP_003899382.1.41791 WP_003899382.1.41803 WP_003899382.1.41820 WP_003899382.1.41828 WP_003899382.1.41829 WP_003899382.1.41860 WP_003899382.1.41912 WP_003899382.1.41921 WP_003899382.1.41933 WP_003899382.1.41944 WP_003899382.1.42043 WP_003899382.1.42075 WP_003899382.1.42078 WP_003899382.1.42094 WP_003899382.1.42112 WP_003899382.1.4212 WP_003899382.1.42122 WP_003899382.1.42183 WP_003899382.1.42188 WP_003899382.1.42202 WP_003899382.1.42208 WP_003899382.1.42247 WP_003899382.1.42255 WP_003899382.1.42278 WP_003899382.1.42304 WP_003899382.1.42309 WP_003899382.1.42370 WP_003899382.1.42385 WP_003899382.1.42400 WP_003899382.1.42409 WP_003899382.1.42414 WP_003899382.1.42430 WP_003899382.1.42465 WP_003899382.1.42467 WP_003899382.1.42473 WP_003899382.1.42474 WP_003899382.1.4248 WP_003899382.1.42494 WP_003899382.1.42519 WP_003899382.1.42524 WP_003899382.1.42534 WP_003899382.1.42562 WP_003899382.1.42568 WP_003899382.1.42570 WP_003899382.1.42618 WP_003899382.1.42660 WP_003899382.1.42695 WP_003899382.1.42704 WP_003899382.1.42705 WP_003899382.1.42722 WP_003899382.1.42777 WP_003899382.1.42835 WP_003899382.1.42839 WP_003899382.1.42842 WP_003899382.1.42905 WP_003899382.1.42916 WP_003899382.1.42930 WP_003899382.1.42971 WP_003899382.1.43005 WP_003899382.1.43009 WP_003899382.1.43082 WP_003899382.1.43087 WP_003899382.1.43098 WP_003899382.1.43208 WP_003899382.1.43236 WP_003899382.1.43246 WP_003899382.1.43255 WP_003899382.1.43266 WP_003899382.1.43269 WP_003899382.1.43296 WP_003899382.1.43306 WP_003899382.1.4335 WP_003899382.1.43368 WP_003899382.1.43395 WP_003899382.1.43462 WP_003899382.1.43475 WP_003899382.1.43478 WP_003899382.1.43484 WP_003899382.1.43557 WP_003899382.1.43578 WP_003899382.1.43588 WP_003899382.1.43643 WP_003899382.1.43664 WP_003899382.1.43684 WP_003899382.1.43686 WP_003899382.1.43706 WP_003899382.1.43716 WP_003899382.1.4377 WP_003899382.1.43781 WP_003899382.1.43794 WP_003899382.1.43815 WP_003899382.1.43846 WP_003899382.1.43861 WP_003899382.1.43863 WP_003899382.1.43866 WP_003899382.1.43885 WP_003899382.1.43897 WP_003899382.1.4390 WP_003899382.1.43902 WP_003899382.1.43936 WP_003899382.1.43937 WP_003899382.1.43965 WP_003899382.1.4399 WP_003899382.1.43993 WP_003899382.1.43996 WP_003899382.1.44 WP_003899382.1.44001 WP_003899382.1.44008 WP_003899382.1.44033 WP_003899382.1.44037 WP_003899382.1.44041 WP_003899382.1.44070 WP_003899382.1.44071 WP_003899382.1.44076 WP_003899382.1.44111 WP_003899382.1.44124 WP_003899382.1.44169 WP_003899382.1.44219 WP_003899382.1.44237 WP_003899382.1.44277 WP_003899382.1.44279 WP_003899382.1.44336 WP_003899382.1.44355 WP_003899382.1.44358 WP_003899382.1.4438 WP_003899382.1.44390 WP_003899382.1.44392 WP_003899382.1.4441 WP_003899382.1.44415 WP_003899382.1.44464 WP_003899382.1.44466 WP_003899382.1.44489 WP_003899382.1.44492 WP_003899382.1.44494 WP_003899382.1.44500 WP_003899382.1.44519 WP_003899382.1.44532 WP_003899382.1.44534 WP_003899382.1.44562 WP_003899382.1.44589 WP_003899382.1.44597 WP_003899382.1.44600 WP_003899382.1.44602 WP_003899382.1.44615 WP_003899382.1.4464 WP_003899382.1.44659 WP_003899382.1.44665 WP_003899382.1.44694 WP_003899382.1.44700 WP_003899382.1.44713 WP_003899382.1.44735 WP_003899382.1.44740 WP_003899382.1.44757 WP_003899382.1.4476 WP_003899382.1.44761 WP_003899382.1.44767 WP_003899382.1.44776 WP_003899382.1.44779 WP_003899382.1.44786 WP_003899382.1.44808 WP_003899382.1.44864 WP_003899382.1.44901 WP_003899382.1.44913 WP_003899382.1.4492 WP_003899382.1.44939 WP_003899382.1.44979 WP_003899382.1.45002 WP_003899382.1.45011 WP_003899382.1.4504 WP_003899382.1.45066 WP_003899382.1.45081 WP_003899382.1.45113 WP_003899382.1.45129 WP_003899382.1.45135 WP_003899382.1.45147 WP_003899382.1.45168 WP_003899382.1.4517 WP_003899382.1.45181 WP_003899382.1.45185 WP_003899382.1.45192 WP_003899382.1.45200 WP_003899382.1.45205 WP_003899382.1.45211 WP_003899382.1.45249 WP_003899382.1.4526 WP_003899382.1.45286 WP_003899382.1.45326 WP_003899382.1.45347 WP_003899382.1.45390 WP_003899382.1.454 WP_003899382.1.45451 WP_003899382.1.45453 WP_003899382.1.45460 WP_003899382.1.45463 WP_003899382.1.45470 WP_003899382.1.45474 WP_003899382.1.45491 WP_003899382.1.45510 WP_003899382.1.45563 WP_003899382.1.45590 WP_003899382.1.45619 WP_003899382.1.45626 WP_003899382.1.45631 WP_003899382.1.45666 WP_003899382.1.45697 WP_003899382.1.4571 WP_003899382.1.45731 WP_003899382.1.45743 WP_003899382.1.45765 WP_003899382.1.45776 WP_003899382.1.45783 WP_003899382.1.45805 WP_003899382.1.45815 WP_003899382.1.45849 WP_003899382.1.45884 WP_003899382.1.4590 WP_003899382.1.45923 WP_003899382.1.45926 WP_003899382.1.45963 WP_003899382.1.45992 WP_003899382.1.46025 WP_003899382.1.46083 WP_003899382.1.46090 WP_003899382.1.46092 WP_003899382.1.46100 WP_003899382.1.46101 WP_003899382.1.46103 WP_003899382.1.46107 WP_003899382.1.46127 WP_003899382.1.46128 WP_003899382.1.46141 WP_003899382.1.46150 WP_003899382.1.46201 WP_003899382.1.46226 WP_003899382.1.4624 WP_003899382.1.46253 WP_003899382.1.46268 WP_003899382.1.46285 WP_003899382.1.46300 WP_003899382.1.46313 WP_003899382.1.46365 WP_003899382.1.46370 WP_003899382.1.46381 WP_003899382.1.46402 WP_003899382.1.46411 WP_003899382.1.4644 WP_003899382.1.46442 WP_003899382.1.46453 WP_003899382.1.46463 WP_003899382.1.46478 WP_003899382.1.46492 WP_003899382.1.4653 WP_003899382.1.46532 WP_003899382.1.46539 WP_003899382.1.46568 WP_003899382.1.46585 WP_003899382.1.46609 WP_003899382.1.46613 WP_003899382.1.46625 WP_003899382.1.46642 WP_003899382.1.46647 WP_003899382.1.46674 WP_003899382.1.46724 WP_003899382.1.46758 WP_003899382.1.46773 WP_003899382.1.46777 WP_003899382.1.46786 WP_003899382.1.46792 WP_003899382.1.46847 WP_003899382.1.46851 WP_003899382.1.4687 WP_003899382.1.46897 WP_003899382.1.46936 WP_003899382.1.46980 WP_003899382.1.47011 WP_003899382.1.47012 WP_003899382.1.47066 WP_003899382.1.47077 WP_003899382.1.47083 WP_003899382.1.47106 WP_003899382.1.47142 WP_003899382.1.47147 WP_003899382.1.47166 WP_003899382.1.47178 WP_003899382.1.47179 WP_003899382.1.47194 WP_003899382.1.47207 WP_003899382.1.47210 WP_003899382.1.47261 WP_003899382.1.47262 WP_003899382.1.47402 WP_003899382.1.47423 WP_003899382.1.47467 WP_003899382.1.47502 WP_003899382.1.4751 WP_003899382.1.47511 WP_003899382.1.47537 WP_003899382.1.47540 WP_003899382.1.47568 WP_003899382.1.47572 WP_003899382.1.4764 WP_003899382.1.47653 WP_003899382.1.47690 WP_003899382.1.4771 WP_003899382.1.47717 WP_003899382.1.47743 WP_003899382.1.47754 WP_003899382.1.47773 WP_003899382.1.47776 WP_003899382.1.47780 WP_003899382.1.47805 WP_003899382.1.47847 WP_003899382.1.47858 WP_003899382.1.47861 WP_003899382.1.47868 WP_003899382.1.47893 WP_003899382.1.47899 WP_003899382.1.479 WP_003899382.1.47912 WP_003899382.1.47913 WP_003899382.1.47926 WP_003899382.1.4794 WP_003899382.1.47943 WP_003899382.1.47959 WP_003899382.1.47974 WP_003899382.1.48004 WP_003899382.1.48039 WP_003899382.1.48050 WP_003899382.1.48097 WP_003899382.1.48101 WP_003899382.1.4813 WP_003899382.1.48143 WP_003899382.1.48152 WP_003899382.1.48155 WP_003899382.1.48170 WP_003899382.1.48173 WP_003899382.1.48177 WP_003899382.1.48185 WP_003899382.1.48204 WP_003899382.1.48219 WP_003899382.1.4823 WP_003899382.1.48240 WP_003899382.1.48287 WP_003899382.1.48330 WP_003899382.1.48333 WP_003899382.1.48348 WP_003899382.1.48354 WP_003899382.1.48372 WP_003899382.1.48383 WP_003899382.1.48388 WP_003899382.1.48419 WP_003899382.1.48423 WP_003899382.1.48443 WP_003899382.1.48450 WP_003899382.1.48462 WP_003899382.1.48543 WP_003899382.1.48550 WP_003899382.1.48605 WP_003899382.1.48618 WP_003899382.1.4863 WP_003899382.1.48648 WP_003899382.1.48658 WP_003899382.1.48666 WP_003899382.1.48779 WP_003899382.1.4878 WP_003899382.1.48798 WP_003899382.1.48802 WP_003899382.1.48826 WP_003899382.1.48831 WP_003899382.1.48843 WP_003899382.1.48857 WP_003899382.1.4890 WP_003899382.1.48946 WP_003899382.1.48979 WP_003899382.1.49017 WP_003899382.1.49048 WP_003899382.1.49059 WP_003899382.1.4906 WP_003899382.1.4907 WP_003899382.1.49103 WP_003899382.1.49110 WP_003899382.1.49111 WP_003899382.1.49112 WP_003899382.1.4919 WP_003899382.1.49251 WP_003899382.1.49254 WP_003899382.1.49263 WP_003899382.1.49296 WP_003899382.1.49335 WP_003899382.1.49337 WP_003899382.1.49419 WP_003899382.1.49426 WP_003899382.1.49437 WP_003899382.1.49439 WP_003899382.1.49474 WP_003899382.1.49506 WP_003899382.1.49516 WP_003899382.1.49523 WP_003899382.1.49526 WP_003899382.1.49532 WP_003899382.1.49588 WP_003899382.1.49678 WP_003899382.1.49699 WP_003899382.1.49709 WP_003899382.1.4971 WP_003899382.1.4972 WP_003899382.1.49736 WP_003899382.1.49746 WP_003899382.1.49764 WP_003899382.1.49773 WP_003899382.1.49796 WP_003899382.1.49814 WP_003899382.1.49815 WP_003899382.1.49816 WP_003899382.1.49839 WP_003899382.1.49857 WP_003899382.1.49878 WP_003899382.1.49880 WP_003899382.1.49944 WP_003899382.1.4999 WP_003899382.1.49990 WP_003899382.1.50068 WP_003899382.1.50077 WP_003899382.1.5008 WP_003899382.1.50081 WP_003899382.1.50122 WP_003899382.1.50126 WP_003899382.1.50149 WP_003899382.1.50162 WP_003899382.1.5018 WP_003899382.1.50194 WP_003899382.1.50218 WP_003899382.1.50235 WP_003899382.1.50249 WP_003899382.1.50265 WP_003899382.1.50271 WP_003899382.1.50324 WP_003899382.1.50347 WP_003899382.1.50372 WP_003899382.1.50398 WP_003899382.1.50444 WP_003899382.1.50466 WP_003899382.1.50472 WP_003899382.1.5048 WP_003899382.1.50498 WP_003899382.1.5050 WP_003899382.1.50540 WP_003899382.1.50554 WP_003899382.1.50557 WP_003899382.1.50601 WP_003899382.1.50610 WP_003899382.1.50632 WP_003899382.1.50633 WP_003899382.1.50642 WP_003899382.1.50655 WP_003899382.1.50659 WP_003899382.1.50683 WP_003899382.1.50689 WP_003899382.1.50692 WP_003899382.1.50714 WP_003899382.1.50729 WP_003899382.1.50756 WP_003899382.1.50784 WP_003899382.1.50794 WP_003899382.1.50841 WP_003899382.1.50877 WP_003899382.1.50981 WP_003899382.1.50987 WP_003899382.1.51003 WP_003899382.1.51009 WP_003899382.1.51037 WP_003899382.1.51074 WP_003899382.1.51082 WP_003899382.1.51101 WP_003899382.1.51116 WP_003899382.1.51149 WP_003899382.1.51156 WP_003899382.1.51157 WP_003899382.1.51213 WP_003899382.1.51232 WP_003899382.1.51239 WP_003899382.1.51247 WP_003899382.1.51266 WP_003899382.1.51279 WP_003899382.1.51291 WP_003899382.1.51294 WP_003899382.1.51301 WP_003899382.1.51329 WP_003899382.1.51391 WP_003899382.1.51422 WP_003899382.1.51445 WP_003899382.1.51455 WP_003899382.1.51466 WP_003899382.1.51468 WP_003899382.1.51478 WP_003899382.1.51497 WP_003899382.1.51520 WP_003899382.1.51593 WP_003899382.1.51628 WP_003899382.1.5164 WP_003899382.1.51647 WP_003899382.1.51660 WP_003899382.1.51696 WP_003899382.1.51721 WP_003899382.1.51788 WP_003899382.1.51801 WP_003899382.1.51817 WP_003899382.1.51819 WP_003899382.1.51854 WP_003899382.1.51923 WP_003899382.1.51942 WP_003899382.1.51948 WP_003899382.1.51963 WP_003899382.1.51969 WP_003899382.1.52000 WP_003899382.1.52001 WP_003899382.1.52003 WP_003899382.1.52036 WP_003899382.1.52038 WP_003899382.1.52046 WP_003899382.1.52059 WP_003899382.1.52069 WP_003899382.1.52082 WP_003899382.1.52102 WP_003899382.1.52166 WP_003899382.1.52168 WP_003899382.1.52173 WP_003899382.1.52206 WP_003899382.1.52216 WP_003899382.1.52238 WP_003899382.1.52241 WP_003899382.1.52280 WP_003899382.1.52314 WP_003899382.1.52385 WP_003899382.1.52390 WP_003899382.1.524 WP_003899382.1.52460 WP_003899382.1.52485 WP_003899382.1.52486 WP_003899382.1.52495 WP_003899382.1.52504 WP_003899382.1.52522 WP_003899382.1.52531 WP_003899382.1.52533 WP_003899382.1.52545 WP_003899382.1.52553 WP_003899382.1.52563 WP_003899382.1.52564 WP_003899382.1.52641 WP_003899382.1.52673 WP_003899382.1.52674 WP_003899382.1.52708 WP_003899382.1.52713 WP_003899382.1.52761 WP_003899382.1.52778 WP_003899382.1.52791 WP_003899382.1.52797 WP_003899382.1.52818 WP_003899382.1.52872 WP_003899382.1.52873 WP_003899382.1.52891 WP_003899382.1.52892 WP_003899382.1.52909 WP_003899382.1.52998 WP_003899382.1.53053 WP_003899382.1.53056 WP_003899382.1.5306 WP_003899382.1.53088 WP_003899382.1.5309 WP_003899382.1.531 WP_003899382.1.53117 WP_003899382.1.53118 WP_003899382.1.53142 WP_003899382.1.53143 WP_003899382.1.53157 WP_003899382.1.53167 WP_003899382.1.53200 WP_003899382.1.53204 WP_003899382.1.53213 WP_003899382.1.53217 WP_003899382.1.53226 WP_003899382.1.53229 WP_003899382.1.53230 WP_003899382.1.53237 WP_003899382.1.5327 WP_003899382.1.53276 WP_003899382.1.53278 WP_003899382.1.533 WP_003899382.1.53302 WP_003899382.1.53306 WP_003899382.1.5334 WP_003899382.1.5335 WP_003899382.1.53353 WP_003899382.1.53381 WP_003899382.1.53413 WP_003899382.1.53458 WP_003899382.1.53460 WP_003899382.1.53480 WP_003899382.1.53517 WP_003899382.1.53522 WP_003899382.1.53525 WP_003899382.1.53526 WP_003899382.1.53553 WP_003899382.1.53628 WP_003899382.1.53643 WP_003899382.1.53667 WP_003899382.1.53679 WP_003899382.1.53715 WP_003899382.1.53730 WP_003899382.1.53742 WP_003899382.1.53754 WP_003899382.1.53775 WP_003899382.1.53787 WP_003899382.1.53803 WP_003899382.1.53818 WP_003899382.1.53822 WP_003899382.1.53853 WP_003899382.1.53865 WP_003899382.1.53888 WP_003899382.1.53900 WP_003899382.1.53912 WP_003899382.1.53914 WP_003899382.1.53952 WP_003899382.1.5398 WP_003899382.1.5408 WP_003899382.1.54089 WP_003899382.1.54093 WP_003899382.1.54099 WP_003899382.1.54112 WP_003899382.1.54125 WP_003899382.1.54141 WP_003899382.1.54179 WP_003899382.1.54206 WP_003899382.1.54218 WP_003899382.1.54225 WP_003899382.1.54227 WP_003899382.1.54232 WP_003899382.1.54241 WP_003899382.1.54245 WP_003899382.1.54247 WP_003899382.1.54260 WP_003899382.1.54275 WP_003899382.1.54280 WP_003899382.1.5429 WP_003899382.1.54294 WP_003899382.1.54314 WP_003899382.1.54347 WP_003899382.1.54351 WP_003899382.1.54370 WP_003899382.1.54428 WP_003899382.1.54449 WP_003899382.1.54494 WP_003899382.1.54514 WP_003899382.1.54519 WP_003899382.1.5452 WP_003899382.1.54531 WP_003899382.1.54537 WP_003899382.1.54553 WP_003899382.1.54555 WP_003899382.1.54575 WP_003899382.1.54633 WP_003899382.1.54686 WP_003899382.1.54687 WP_003899382.1.54705 WP_003899382.1.54730 WP_003899382.1.54732 WP_003899382.1.5475 WP_003899382.1.54797 WP_003899382.1.54807 WP_003899382.1.54836 WP_003899382.1.54838 WP_003899382.1.54860 WP_003899382.1.54888 WP_003899382.1.54897 WP_003899382.1.54905 WP_003899382.1.54909 WP_003899382.1.54937 WP_003899382.1.54939 WP_003899382.1.54944 WP_003899382.1.54945 WP_003899382.1.54964 WP_003899382.1.55015 WP_003899382.1.55022 WP_003899382.1.55023 WP_003899382.1.55051 WP_003899382.1.55072 WP_003899382.1.55088 WP_003899382.1.55106 WP_003899382.1.55126 WP_003899382.1.55128 WP_003899382.1.55140 WP_003899382.1.55150 WP_003899382.1.55210 WP_003899382.1.55248 WP_003899382.1.55258 WP_003899382.1.55267 WP_003899382.1.55279 WP_003899382.1.55307 WP_003899382.1.55326 WP_003899382.1.55328 WP_003899382.1.5533 WP_003899382.1.55345 WP_003899382.1.55396 WP_003899382.1.55398 WP_003899382.1.55441 WP_003899382.1.55459 WP_003899382.1.55501 WP_003899382.1.55504 WP_003899382.1.55578 WP_003899382.1.55626 WP_003899382.1.55641 WP_003899382.1.5569 WP_003899382.1.55723 WP_003899382.1.55735 WP_003899382.1.5574 WP_003899382.1.55772 WP_003899382.1.55802 WP_003899382.1.55807 WP_003899382.1.55821 WP_003899382.1.5583 WP_003899382.1.55849 WP_003899382.1.55856 WP_003899382.1.55860 WP_003899382.1.55882 WP_003899382.1.55883 WP_003899382.1.55894 WP_003899382.1.55902 WP_003899382.1.55908 WP_003899382.1.55909 WP_003899382.1.55961 WP_003899382.1.55977 WP_003899382.1.56028 WP_003899382.1.56057 WP_003899382.1.56060 WP_003899382.1.56107 WP_003899382.1.56132 WP_003899382.1.56163 WP_003899382.1.56167 WP_003899382.1.56178 WP_003899382.1.56287 WP_003899382.1.56292 WP_003899382.1.56327 WP_003899382.1.56341 WP_003899382.1.56359 WP_003899382.1.56365 WP_003899382.1.56394 WP_003899382.1.56443 WP_003899382.1.56473 WP_003899382.1.56478 WP_003899382.1.56500 WP_003899382.1.56517 WP_003899382.1.56534 WP_003899382.1.56593 WP_003899382.1.56625 WP_003899382.1.56637 WP_003899382.1.56670 WP_003899382.1.56697 WP_003899382.1.567 WP_003899382.1.56701 WP_003899382.1.56709 WP_003899382.1.56743 WP_003899382.1.56755 WP_003899382.1.56764 WP_003899382.1.56769 WP_003899382.1.56770 WP_003899382.1.56795 WP_003899382.1.5681 WP_003899382.1.56827 WP_003899382.1.56839 WP_003899382.1.56868 WP_003899382.1.56869 WP_003899382.1.56915 WP_003899382.1.56926 WP_003899382.1.56961 WP_003899382.1.56971 WP_003899382.1.56972 WP_003899382.1.57023 WP_003899382.1.57035 WP_003899382.1.57077 WP_003899382.1.57087 WP_003899382.1.57094 WP_003899382.1.57134 WP_003899382.1.57151 WP_003899382.1.57169 WP_003899382.1.57208 WP_003899382.1.57212 WP_003899382.1.57230 WP_003899382.1.5725 WP_003899382.1.5727 WP_003899382.1.57273 WP_003899382.1.573 WP_003899382.1.57314 WP_003899382.1.57328 WP_003899382.1.57331 WP_003899382.1.57351 WP_003899382.1.57352 WP_003899382.1.57380 WP_003899382.1.57430 WP_003899382.1.5744 WP_003899382.1.57440 WP_003899382.1.5745 WP_003899382.1.57461 WP_003899382.1.57469 WP_003899382.1.57489 WP_003899382.1.575 WP_003899382.1.57509 WP_003899382.1.57519 WP_003899382.1.57525 WP_003899382.1.57551 WP_003899382.1.5758 WP_003899382.1.57596 WP_003899382.1.57604 WP_003899382.1.57617 WP_003899382.1.57619 WP_003899382.1.57627 WP_003899382.1.57642 WP_003899382.1.57667 WP_003899382.1.57675 WP_003899382.1.57689 WP_003899382.1.57708 WP_003899382.1.57794 WP_003899382.1.57821 WP_003899382.1.57825 WP_003899382.1.57843 WP_003899382.1.57906 WP_003899382.1.57924 WP_003899382.1.57926 WP_003899382.1.57930 WP_003899382.1.57957 WP_003899382.1.57960 WP_003899382.1.57964 WP_003899382.1.57991 WP_003899382.1.58086 WP_003899382.1.58103 WP_003899382.1.58108 WP_003899382.1.5811 WP_003899382.1.58121 WP_003899382.1.58145 WP_003899382.1.58164 WP_003899382.1.582 WP_003899382.1.58202 WP_003899382.1.58209 WP_003899382.1.58215 WP_003899382.1.5824 WP_003899382.1.58259 WP_003899382.1.58283 WP_003899382.1.5830 WP_003899382.1.58303 WP_003899382.1.58311 WP_003899382.1.58359 WP_003899382.1.58393 WP_003899382.1.58431 WP_003899382.1.58457 WP_003899382.1.58488 WP_003899382.1.58518 WP_003899382.1.58534 WP_003899382.1.58559 WP_003899382.1.58567 WP_003899382.1.58573 WP_003899382.1.58602 WP_003899382.1.58612 WP_003899382.1.58630 WP_003899382.1.5865 WP_003899382.1.58671 WP_003899382.1.58690 WP_003899382.1.58702 WP_003899382.1.58743 WP_003899382.1.58754 WP_003899382.1.5879 WP_003899382.1.5881 WP_003899382.1.58824 WP_003899382.1.58848 WP_003899382.1.58857 WP_003899382.1.58891 WP_003899382.1.58892 WP_003899382.1.5890 WP_003899382.1.58921 WP_003899382.1.58930 WP_003899382.1.58939 WP_003899382.1.58941 WP_003899382.1.58953 WP_003899382.1.58961 WP_003899382.1.5898 WP_003899382.1.59029 WP_003899382.1.59037 WP_003899382.1.59044 WP_003899382.1.59085 WP_003899382.1.59088 WP_003899382.1.59112 WP_003899382.1.5914 WP_003899382.1.59147 WP_003899382.1.59166 WP_003899382.1.59209 WP_003899382.1.59237 WP_003899382.1.59240 WP_003899382.1.59253 WP_003899382.1.59254 WP_003899382.1.59262 WP_003899382.1.59270 WP_003899382.1.5928 WP_003899382.1.59304 WP_003899382.1.59305 WP_003899382.1.59309 WP_003899382.1.59316 WP_003899382.1.59326 WP_003899382.1.59328 WP_003899382.1.59333 WP_003899382.1.59338 WP_003899382.1.59487 WP_003899382.1.59537 WP_003899382.1.59677 WP_003899382.1.59732 WP_003899382.1.59738 WP_003899382.1.59750 WP_003899382.1.59757 WP_003899382.1.59761 WP_003899382.1.59808 WP_003899382.1.59850 WP_003899382.1.59856 WP_003899382.1.59860 WP_003899382.1.59861 WP_003899382.1.5987 WP_003899382.1.59878 WP_003899382.1.59888 WP_003899382.1.59952 WP_003899382.1.5996 WP_003899382.1.59961 WP_003899382.1.6000 WP_003899382.1.60007 WP_003899382.1.60016 WP_003899382.1.6003 WP_003899382.1.6007 WP_003899382.1.60121 WP_003899382.1.60125 WP_003899382.1.60135 WP_003899382.1.60139 WP_003899382.1.60152 WP_003899382.1.60171 WP_003899382.1.60197 WP_003899382.1.6020 WP_003899382.1.60205 WP_003899382.1.60207 WP_003899382.1.60215 WP_003899382.1.60217 WP_003899382.1.60267 WP_003899382.1.60288 WP_003899382.1.60291 WP_003899382.1.60301 WP_003899382.1.60305 WP_003899382.1.60312 WP_003899382.1.60313 WP_003899382.1.60314 WP_003899382.1.60367 WP_003899382.1.60376 WP_003899382.1.60403 WP_003899382.1.60413 WP_003899382.1.60421 WP_003899382.1.60451 WP_003899382.1.60460 WP_003899382.1.60479 WP_003899382.1.60487 WP_003899382.1.60512 WP_003899382.1.60573 WP_003899382.1.60632 WP_003899382.1.60657 WP_003899382.1.60687 WP_003899382.1.60689 WP_003899382.1.60727 WP_003899382.1.60738 WP_003899382.1.60763 WP_003899382.1.6077 WP_003899382.1.60791 WP_003899382.1.60834 WP_003899382.1.60870 WP_003899382.1.60878 WP_003899382.1.60879 WP_003899382.1.60913 WP_003899382.1.60978 WP_003899382.1.61000 WP_003899382.1.61001 WP_003899382.1.61012 WP_003899382.1.61014 WP_003899382.1.61015 WP_003899382.1.61052 WP_003899382.1.61065 WP_003899382.1.61100 WP_003899382.1.61101 WP_003899382.1.61142 WP_003899382.1.61198 WP_003899382.1.612 WP_003899382.1.61234 WP_003899382.1.61281 WP_003899382.1.61314 WP_003899382.1.61321 WP_003899382.1.61326 WP_003899382.1.61328 WP_003899382.1.61368 WP_003899382.1.61406 WP_003899382.1.61420 WP_003899382.1.61422 WP_003899382.1.61425 WP_003899382.1.61428 WP_003899382.1.61494 WP_003899382.1.61522 WP_003899382.1.61552 WP_003899382.1.61557 WP_003899382.1.61567 WP_003899382.1.61571 WP_003899382.1.61573 WP_003899382.1.61584 WP_003899382.1.61586 WP_003899382.1.6159 WP_003899382.1.61592 WP_003899382.1.6160 WP_003899382.1.61614 WP_003899382.1.6163 WP_003899382.1.61655 WP_003899382.1.61665 WP_003899382.1.61669 WP_003899382.1.61682 WP_003899382.1.61692 WP_003899382.1.61719 WP_003899382.1.61728 WP_003899382.1.61750 WP_003899382.1.61754 WP_003899382.1.61755 WP_003899382.1.61757 WP_003899382.1.6179 WP_003899382.1.61816 WP_003899382.1.61842 WP_003899382.1.61850 WP_003899382.1.61862 WP_003899382.1.61865 WP_003899382.1.61868 WP_003899382.1.61911 WP_003899382.1.61941 WP_003899382.1.61953 WP_003899382.1.61979 WP_003899382.1.61986 WP_003899382.1.61987 WP_003899382.1.62021 WP_003899382.1.62087 WP_003899382.1.62089 WP_003899382.1.62101 WP_003899382.1.62104 WP_003899382.1.6211 WP_003899382.1.62132 WP_003899382.1.62162 WP_003899382.1.62230 WP_003899382.1.62238 WP_003899382.1.62249 WP_003899382.1.62270 WP_003899382.1.62281 WP_003899382.1.62307 WP_003899382.1.6231 WP_003899382.1.62359 WP_003899382.1.62371 WP_003899382.1.62379 WP_003899382.1.62395 WP_003899382.1.62408 WP_003899382.1.62468 WP_003899382.1.6248 WP_003899382.1.62508 WP_003899382.1.62565 WP_003899382.1.62594 WP_003899382.1.62606 WP_003899382.1.62616 WP_003899382.1.62666 WP_003899382.1.62687 WP_003899382.1.62715 WP_003899382.1.62730 WP_003899382.1.62738 WP_003899382.1.62761 WP_003899382.1.62786 WP_003899382.1.62813 WP_003899382.1.62839 WP_003899382.1.62841 WP_003899382.1.62909 WP_003899382.1.62936 WP_003899382.1.6294 WP_003899382.1.6295 WP_003899382.1.63007 WP_003899382.1.63019 WP_003899382.1.63032 WP_003899382.1.63037 WP_003899382.1.63064 WP_003899382.1.63066 WP_003899382.1.6308 WP_003899382.1.63096 WP_003899382.1.63106 WP_003899382.1.6314 WP_003899382.1.63144 WP_003899382.1.63154 WP_003899382.1.63161 WP_003899382.1.63166 WP_003899382.1.63175 WP_003899382.1.63194 WP_003899382.1.6322 WP_003899382.1.63222 WP_003899382.1.63247 WP_003899382.1.6328 WP_003899382.1.63291 WP_003899382.1.63312 WP_003899382.1.63317 WP_003899382.1.63331 WP_003899382.1.63373 WP_003899382.1.63384 WP_003899382.1.63403 WP_003899382.1.63428 WP_003899382.1.63464 WP_003899382.1.63483 WP_003899382.1.63502 WP_003899382.1.63504 WP_003899382.1.63522 WP_003899382.1.63530 WP_003899382.1.63564 WP_003899382.1.63567 WP_003899382.1.63596 WP_003899382.1.63600 WP_003899382.1.63623 WP_003899382.1.63624 WP_003899382.1.63625 WP_003899382.1.63627 WP_003899382.1.63654 WP_003899382.1.63662 WP_003899382.1.63711 WP_003899382.1.63734 WP_003899382.1.63807 WP_003899382.1.63844 WP_003899382.1.63888 WP_003899382.1.63913 WP_003899382.1.63915 WP_003899382.1.63918 WP_003899382.1.63961 WP_003899382.1.63970 WP_003899382.1.64000 WP_003899382.1.64027 WP_003899382.1.64058 WP_003899382.1.64065 WP_003899382.1.6407 WP_003899382.1.64082 WP_003899382.1.64091 WP_003899382.1.64102 WP_003899382.1.64104 WP_003899382.1.64119 WP_003899382.1.64169 WP_003899382.1.64219 WP_003899382.1.6422 WP_003899382.1.64222 WP_003899382.1.64223 WP_003899382.1.64228 WP_003899382.1.64235 WP_003899382.1.64249 WP_003899382.1.6427 WP_003899382.1.64278 WP_003899382.1.64287 WP_003899382.1.64414 WP_003899382.1.64419 WP_003899382.1.6443 WP_003899382.1.64463 WP_003899382.1.64480 WP_003899382.1.64497 WP_003899382.1.64506 WP_003899382.1.64511 WP_003899382.1.64513 WP_003899382.1.64514 WP_003899382.1.64515 WP_003899382.1.64522 WP_003899382.1.64526 WP_003899382.1.64543 WP_003899382.1.6456 WP_003899382.1.64588 WP_003899382.1.64589 WP_003899382.1.64594 WP_003899382.1.64595 WP_003899382.1.64608 WP_003899382.1.64619 WP_003899382.1.64629 WP_003899382.1.6464 WP_003899382.1.64664 WP_003899382.1.64669 WP_003899382.1.64672 WP_003899382.1.64680 WP_003899382.1.64682 WP_003899382.1.64727 WP_003899382.1.64729 WP_003899382.1.64774 WP_003899382.1.64776 WP_003899382.1.64802 WP_003899382.1.64832 WP_003899382.1.6486 WP_003899382.1.64870 WP_003899382.1.64898 WP_003899382.1.64922 WP_003899382.1.64924 WP_003899382.1.6493 WP_003899382.1.64937 WP_003899382.1.64941 WP_003899382.1.65001 WP_003899382.1.65026 WP_003899382.1.65053 WP_003899382.1.65070 WP_003899382.1.65079 WP_003899382.1.65102 WP_003899382.1.65157 WP_003899382.1.65181 WP_003899382.1.65212 WP_003899382.1.65229 WP_003899382.1.6523 WP_003899382.1.65289 WP_003899382.1.65291 WP_003899382.1.65315 WP_003899382.1.65329 WP_003899382.1.65359 WP_003899382.1.6536 WP_003899382.1.65374 WP_003899382.1.65414 WP_003899382.1.65416 WP_003899382.1.65433 WP_003899382.1.65455 WP_003899382.1.65467 WP_003899382.1.65488 WP_003899382.1.65529 WP_003899382.1.65539 WP_003899382.1.65583 WP_003899382.1.65623 WP_003899382.1.65635 WP_003899382.1.65637 WP_003899382.1.65648 WP_003899382.1.65683 WP_003899382.1.65686 WP_003899382.1.65688 WP_003899382.1.65707 WP_003899382.1.65746 WP_003899382.1.65747 WP_003899382.1.65816 WP_003899382.1.65830 WP_003899382.1.65858 WP_003899382.1.65862 WP_003899382.1.65869 WP_003899382.1.65893 WP_003899382.1.65929 WP_003899382.1.65932 WP_003899382.1.65958 WP_003899382.1.65974 WP_003899382.1.66004 WP_003899382.1.6606 WP_003899382.1.66089 WP_003899382.1.66149 WP_003899382.1.66151 WP_003899382.1.66229 WP_003899382.1.66276 WP_003899382.1.66293 WP_003899382.1.66297 WP_003899382.1.66323 WP_003899382.1.66325 WP_003899382.1.6633 WP_003899382.1.66334 WP_003899382.1.66355 WP_003899382.1.66367 WP_003899382.1.66394 WP_003899382.1.66455 WP_003899382.1.66464 WP_003899382.1.66466 WP_003899382.1.66487 WP_003899382.1.66544 WP_003899382.1.66558 WP_003899382.1.66580 WP_003899382.1.66582 WP_003899382.1.66612 WP_003899382.1.66615 WP_003899382.1.66617 WP_003899382.1.66635 WP_003899382.1.66656 WP_003899382.1.66663 WP_003899382.1.66675 WP_003899382.1.66715 WP_003899382.1.66718 WP_003899382.1.66762 WP_003899382.1.66776 WP_003899382.1.66808 WP_003899382.1.66817 WP_003899382.1.66819 WP_003899382.1.66826 WP_003899382.1.66830 WP_003899382.1.66842 WP_003899382.1.66868 WP_003899382.1.66878 WP_003899382.1.66880 WP_003899382.1.66893 WP_003899382.1.66961 WP_003899382.1.67005 WP_003899382.1.6704 WP_003899382.1.67044 WP_003899382.1.67061 WP_003899382.1.67089 WP_003899382.1.67098 WP_003899382.1.67146 WP_003899382.1.67170 WP_003899382.1.67198 WP_003899382.1.6720 WP_003899382.1.67207 WP_003899382.1.67218 WP_003899382.1.67220 WP_003899382.1.67225 WP_003899382.1.67231 WP_003899382.1.6724 WP_003899382.1.67257 WP_003899382.1.67298 WP_003899382.1.67307 WP_003899382.1.67332 WP_003899382.1.67346 WP_003899382.1.67354 WP_003899382.1.67360 WP_003899382.1.67381 WP_003899382.1.67396 WP_003899382.1.67417 WP_003899382.1.67422 WP_003899382.1.67453 WP_003899382.1.67459 WP_003899382.1.6746 WP_003899382.1.67473 WP_003899382.1.67481 WP_003899382.1.67482 WP_003899382.1.67496 WP_003899382.1.67499 WP_003899382.1.67516 WP_003899382.1.67523 WP_003899382.1.67536 WP_003899382.1.67575 WP_003899382.1.67587 WP_003899382.1.67598 WP_003899382.1.67602 WP_003899382.1.67630 WP_003899382.1.67679 WP_003899382.1.67692 WP_003899382.1.67744 WP_003899382.1.6775 WP_003899382.1.6777 WP_003899382.1.67809 WP_003899382.1.67844 WP_003899382.1.67848 WP_003899382.1.67870 WP_003899382.1.67888 WP_003899382.1.67915 WP_003899382.1.67980 WP_003899382.1.67982 WP_003899382.1.68022 WP_003899382.1.68029 WP_003899382.1.68037 WP_003899382.1.68038 WP_003899382.1.68057 WP_003899382.1.68083 WP_003899382.1.68088 WP_003899382.1.68110 WP_003899382.1.68153 WP_003899382.1.68164 WP_003899382.1.68169 WP_003899382.1.68193 WP_003899382.1.68212 WP_003899382.1.68227 WP_003899382.1.68243 WP_003899382.1.6825 WP_003899382.1.68297 WP_003899382.1.68309 WP_003899382.1.68325 WP_003899382.1.68340 WP_003899382.1.68384 WP_003899382.1.68388 WP_003899382.1.68429 WP_003899382.1.6843 WP_003899382.1.68433 WP_003899382.1.68444 WP_003899382.1.68465 WP_003899382.1.68484 WP_003899382.1.68518 WP_003899382.1.68569 WP_003899382.1.68576 WP_003899382.1.68580 WP_003899382.1.68586 WP_003899382.1.68623 WP_003899382.1.68624 WP_003899382.1.68637 WP_003899382.1.68646 WP_003899382.1.68667 WP_003899382.1.68669 WP_003899382.1.68672 WP_003899382.1.68684 WP_003899382.1.68704 WP_003899382.1.68708 WP_003899382.1.6872 WP_003899382.1.68730 WP_003899382.1.68734 WP_003899382.1.68748 WP_003899382.1.68754 WP_003899382.1.6876 WP_003899382.1.68761 WP_003899382.1.68763 WP_003899382.1.68766 WP_003899382.1.68774 WP_003899382.1.68796 WP_003899382.1.68824 WP_003899382.1.68832 WP_003899382.1.68833 WP_003899382.1.68841 WP_003899382.1.68859 WP_003899382.1.68876 WP_003899382.1.68906 WP_003899382.1.68916 WP_003899382.1.68923 WP_003899382.1.68945 WP_003899382.1.6896 WP_003899382.1.68984 WP_003899382.1.68997 WP_003899382.1.69008 WP_003899382.1.69076 WP_003899382.1.69079 WP_003899382.1.6908 WP_003899382.1.69082 WP_003899382.1.69178 WP_003899382.1.69208 WP_003899382.1.69256 WP_003899382.1.69311 WP_003899382.1.69315 WP_003899382.1.69322 WP_003899382.1.69342 WP_003899382.1.6936 WP_003899382.1.69369 WP_003899382.1.69374 WP_003899382.1.69401 WP_003899382.1.69426 WP_003899382.1.69427 WP_003899382.1.69429 WP_003899382.1.6949 WP_003899382.1.6951 WP_003899382.1.69511 WP_003899382.1.69526 WP_003899382.1.69528 WP_003899382.1.69547 WP_003899382.1.69573 WP_003899382.1.69581 WP_003899382.1.6960 WP_003899382.1.69617 WP_003899382.1.69634 WP_003899382.1.69647 WP_003899382.1.69659 WP_003899382.1.69673 WP_003899382.1.69682 WP_003899382.1.69684 WP_003899382.1.69686 WP_003899382.1.69707 WP_003899382.1.69709 WP_003899382.1.69723 WP_003899382.1.69736 WP_003899382.1.69778 WP_003899382.1.69800 WP_003899382.1.69802 WP_003899382.1.69845 WP_003899382.1.69870 WP_003899382.1.69873 WP_003899382.1.69898 WP_003899382.1.69913 WP_003899382.1.69925 WP_003899382.1.69931 WP_003899382.1.69938 WP_003899382.1.69955 WP_003899382.1.69957 WP_003899382.1.69981 WP_003899382.1.69990 WP_003899382.1.70 WP_003899382.1.70000 WP_003899382.1.70017 WP_003899382.1.70032 WP_003899382.1.70055 WP_003899382.1.70062 WP_003899382.1.70072 WP_003899382.1.70131 WP_003899382.1.70132 WP_003899382.1.7022 WP_003899382.1.70227 WP_003899382.1.70255 WP_003899382.1.70271 WP_003899382.1.70274 WP_003899382.1.7029 WP_003899382.1.70325 WP_003899382.1.70328 WP_003899382.1.70356 WP_003899382.1.70368 WP_003899382.1.70369 WP_003899382.1.70418 WP_003899382.1.70422 WP_003899382.1.70435 WP_003899382.1.70444 WP_003899382.1.70463 WP_003899382.1.70471 WP_003899382.1.70480 WP_003899382.1.70494 WP_003899382.1.70498 WP_003899382.1.70505 WP_003899382.1.70525 WP_003899382.1.70573 WP_003899382.1.70577 WP_003899382.1.70610 WP_003899382.1.70615 WP_003899382.1.70618 WP_003899382.1.70622 WP_003899382.1.70626 WP_003899382.1.70668 WP_003899382.1.70704 WP_003899382.1.70729 WP_003899382.1.70757 WP_003899382.1.70782 WP_003899382.1.70796 WP_003899382.1.70830 WP_003899382.1.70834 WP_003899382.1.7084 WP_003899382.1.70840 WP_003899382.1.70871 WP_003899382.1.70915 WP_003899382.1.70955 WP_003899382.1.70958 WP_003899382.1.70964 WP_003899382.1.70976 WP_003899382.1.71015 WP_003899382.1.71026 WP_003899382.1.71063 WP_003899382.1.71076 WP_003899382.1.71083 WP_003899382.1.71118 WP_003899382.1.7113 WP_003899382.1.71187 WP_003899382.1.71255 WP_003899382.1.71258 WP_003899382.1.71289 WP_003899382.1.71326 WP_003899382.1.71329 WP_003899382.1.71331 WP_003899382.1.71344 WP_003899382.1.71440 WP_003899382.1.71457 WP_003899382.1.71490 WP_003899382.1.71509 WP_003899382.1.71516 WP_003899382.1.71517 WP_003899382.1.71527 WP_003899382.1.71532 WP_003899382.1.71545 WP_003899382.1.71546 WP_003899382.1.71569 WP_003899382.1.71604 WP_003899382.1.71630 WP_003899382.1.71638 WP_003899382.1.71654 WP_003899382.1.71664 WP_003899382.1.71665 WP_003899382.1.71701 WP_003899382.1.71718 WP_003899382.1.71731 WP_003899382.1.71781 WP_003899382.1.71803 WP_003899382.1.7185 WP_003899382.1.71871 WP_003899382.1.71909 WP_003899382.1.71957 WP_003899382.1.71970 WP_003899382.1.72047 WP_003899382.1.72061 WP_003899382.1.72062 WP_003899382.1.72072 WP_003899382.1.72111 WP_003899382.1.72122 WP_003899382.1.72128 WP_003899382.1.72143 WP_003899382.1.7216 WP_003899382.1.72168 WP_003899382.1.72179 WP_003899382.1.72209 WP_003899382.1.72227 WP_003899382.1.7224 WP_003899382.1.72332 WP_003899382.1.72380 WP_003899382.1.72401 WP_003899382.1.72405 WP_003899382.1.72420 WP_003899382.1.72441 WP_003899382.1.72451 WP_003899382.1.72452 WP_003899382.1.72457 WP_003899382.1.72459 WP_003899382.1.72460 WP_003899382.1.72466 WP_003899382.1.72488 WP_003899382.1.72492 WP_003899382.1.72506 WP_003899382.1.72543 WP_003899382.1.7256 WP_003899382.1.72576 WP_003899382.1.72578 WP_003899382.1.72585 WP_003899382.1.72591 WP_003899382.1.72592 WP_003899382.1.72640 WP_003899382.1.72661 WP_003899382.1.72739 WP_003899382.1.72744 WP_003899382.1.72755 WP_003899382.1.72759 WP_003899382.1.72784 WP_003899382.1.72792 WP_003899382.1.72826 WP_003899382.1.72852 WP_003899382.1.72879 WP_003899382.1.72880 WP_003899382.1.72938 WP_003899382.1.72954 WP_003899382.1.72957 WP_003899382.1.72973 WP_003899382.1.7298 WP_003899382.1.72982 WP_003899382.1.72988 WP_003899382.1.72993 WP_003899382.1.73006 WP_003899382.1.73025 WP_003899382.1.73028 WP_003899382.1.73042 WP_003899382.1.73045 WP_003899382.1.73092 WP_003899382.1.73118 WP_003899382.1.7312 WP_003899382.1.73127 WP_003899382.1.73134 WP_003899382.1.73150 WP_003899382.1.73154 WP_003899382.1.73163 WP_003899382.1.73182 WP_003899382.1.73205 WP_003899382.1.73310 WP_003899382.1.73365 WP_003899382.1.73391 WP_003899382.1.73404 WP_003899382.1.73424 WP_003899382.1.73445 WP_003899382.1.73453 WP_003899382.1.73465 WP_003899382.1.73466 WP_003899382.1.73471 WP_003899382.1.73478 WP_003899382.1.73482 WP_003899382.1.73507 WP_003899382.1.73532 WP_003899382.1.73550 WP_003899382.1.73564 WP_003899382.1.73623 WP_003899382.1.73629 WP_003899382.1.73644 WP_003899382.1.7366 WP_003899382.1.73661 WP_003899382.1.73688 WP_003899382.1.73723 WP_003899382.1.73744 WP_003899382.1.73750 WP_003899382.1.73760 WP_003899382.1.73774 WP_003899382.1.7379 WP_003899382.1.73813 WP_003899382.1.73840 WP_003899382.1.73876 WP_003899382.1.7389 WP_003899382.1.73986 WP_003899382.1.74016 WP_003899382.1.74039 WP_003899382.1.74083 WP_003899382.1.74107 WP_003899382.1.74120 WP_003899382.1.74129 WP_003899382.1.7417 WP_003899382.1.74190 WP_003899382.1.74210 WP_003899382.1.7423 WP_003899382.1.74259 WP_003899382.1.74262 WP_003899382.1.74269 WP_003899382.1.74282 WP_003899382.1.74291 WP_003899382.1.74296 WP_003899382.1.7432 WP_003899382.1.74347 WP_003899382.1.7436 WP_003899382.1.74378 WP_003899382.1.74382 WP_003899382.1.74395 WP_003899382.1.74400 WP_003899382.1.74401 WP_003899382.1.74432 WP_003899382.1.74442 WP_003899382.1.74487 WP_003899382.1.74499 WP_003899382.1.74504 WP_003899382.1.74511 WP_003899382.1.74523 WP_003899382.1.74525 WP_003899382.1.74551 WP_003899382.1.74555 WP_003899382.1.74628 WP_003899382.1.74641 WP_003899382.1.74653 WP_003899382.1.74660 WP_003899382.1.74683 WP_003899382.1.74725 WP_003899382.1.74820 WP_003899382.1.74870 WP_003899382.1.74881 WP_003899382.1.74888 WP_003899382.1.74952 WP_003899382.1.74988 WP_003899382.1.75043 WP_003899382.1.75055 WP_003899382.1.75078 WP_003899382.1.75081 WP_003899382.1.75120 WP_003899382.1.75163 WP_003899382.1.75188 WP_003899382.1.75200 WP_003899382.1.75202 WP_003899382.1.75234 WP_003899382.1.75239 WP_003899382.1.75250 WP_003899382.1.75263 WP_003899382.1.75281 WP_003899382.1.7535 WP_003899382.1.75376 WP_003899382.1.75391 WP_003899382.1.75395 WP_003899382.1.75441 WP_003899382.1.75510 WP_003899382.1.75581 WP_003899382.1.75598 WP_003899382.1.75635 WP_003899382.1.75645 WP_003899382.1.75665 WP_003899382.1.75671 WP_003899382.1.75741 WP_003899382.1.75772 WP_003899382.1.75774 WP_003899382.1.75811 WP_003899382.1.75833 WP_003899382.1.7585 WP_003899382.1.75868 WP_003899382.1.75878 WP_003899382.1.75927 WP_003899382.1.75946 WP_003899382.1.75968 WP_003899382.1.75974 WP_003899382.1.76007 WP_003899382.1.76016 WP_003899382.1.76032 WP_003899382.1.76037 WP_003899382.1.7604 WP_003899382.1.76045 WP_003899382.1.76064 WP_003899382.1.76110 WP_003899382.1.76126 WP_003899382.1.76133 WP_003899382.1.76138 WP_003899382.1.76157 WP_003899382.1.76172 WP_003899382.1.76177 WP_003899382.1.76183 WP_003899382.1.76209 WP_003899382.1.76239 WP_003899382.1.76272 WP_003899382.1.76277 WP_003899382.1.76280 WP_003899382.1.76281 WP_003899382.1.76291 WP_003899382.1.76297 WP_003899382.1.76360 WP_003899382.1.76379 WP_003899382.1.76403 WP_003899382.1.76413 WP_003899382.1.76414 WP_003899382.1.76427 WP_003899382.1.76436 WP_003899382.1.76442 WP_003899382.1.76443 WP_003899382.1.76456 WP_003899382.1.76521 WP_003899382.1.76533 WP_003899382.1.76616 WP_003899382.1.76625 WP_003899382.1.76629 WP_003899382.1.76635 WP_003899382.1.76638 WP_003899382.1.76639 WP_003899382.1.76644 WP_003899382.1.76678 WP_003899382.1.76679 WP_003899382.1.76734 WP_003899382.1.76750 WP_003899382.1.76754 WP_003899382.1.76757 WP_003899382.1.76781 WP_003899382.1.76818 WP_003899382.1.76824 WP_003899382.1.76835 WP_003899382.1.76873 WP_003899382.1.76881 WP_003899382.1.76888 WP_003899382.1.76900 WP_003899382.1.7691 WP_003899382.1.76947 WP_003899382.1.76954 WP_003899382.1.76955 WP_003899382.1.76963 WP_003899382.1.77000 WP_003899382.1.77021 WP_003899382.1.77056 WP_003899382.1.77065 WP_003899382.1.77075 WP_003899382.1.77107 WP_003899382.1.77115 WP_003899382.1.77118 WP_003899382.1.77141 WP_003899382.1.77142 WP_003899382.1.77250 WP_003899382.1.77252 WP_003899382.1.77260 WP_003899382.1.77266 WP_003899382.1.77280 WP_003899382.1.77285 WP_003899382.1.77312 WP_003899382.1.77348 WP_003899382.1.77351 WP_003899382.1.77352 WP_003899382.1.77361 WP_003899382.1.774 WP_003899382.1.7740 WP_003899382.1.77463 WP_003899382.1.77474 WP_003899382.1.7748 WP_003899382.1.77484 WP_003899382.1.77491 WP_003899382.1.77499 WP_003899382.1.77510 WP_003899382.1.77530 WP_003899382.1.77554 WP_003899382.1.77559 WP_003899382.1.77599 WP_003899382.1.77605 WP_003899382.1.7762 WP_003899382.1.77649 WP_003899382.1.77654 WP_003899382.1.7766 WP_003899382.1.77667 WP_003899382.1.77704 WP_003899382.1.77706 WP_003899382.1.77726 WP_003899382.1.77774 WP_003899382.1.7778 WP_003899382.1.77790 WP_003899382.1.77809 WP_003899382.1.77820 WP_003899382.1.77855 WP_003899382.1.77865 WP_003899382.1.77868 WP_003899382.1.77890 WP_003899382.1.77909 WP_003899382.1.77911 WP_003899382.1.77931 WP_003899382.1.77984 WP_003899382.1.78020 WP_003899382.1.78024 WP_003899382.1.78075 WP_003899382.1.78084 WP_003899382.1.78086 WP_003899382.1.7809 WP_003899382.1.78098 WP_003899382.1.78105 WP_003899382.1.78113 WP_003899382.1.78136 WP_003899382.1.78162 WP_003899382.1.78200 WP_003899382.1.78216 WP_003899382.1.78236 WP_003899382.1.78238 WP_003899382.1.78322 WP_003899382.1.78338 WP_003899382.1.7836 WP_003899382.1.78360 WP_003899382.1.78386 WP_003899382.1.7844 WP_003899382.1.78459 WP_003899382.1.78488 WP_003899382.1.7849 WP_003899382.1.78499 WP_003899382.1.78516 WP_003899382.1.78524 WP_003899382.1.78526 WP_003899382.1.78538 WP_003899382.1.78545 WP_003899382.1.78574 WP_003899382.1.78580 WP_003899382.1.7860 WP_003899382.1.78620 WP_003899382.1.78646 WP_003899382.1.78648 WP_003899382.1.78649 WP_003899382.1.78655 WP_003899382.1.7869 WP_003899382.1.78692 WP_003899382.1.78760 WP_003899382.1.78766 WP_003899382.1.78778 WP_003899382.1.78784 WP_003899382.1.78788 WP_003899382.1.78790 WP_003899382.1.78793 WP_003899382.1.78860 WP_003899382.1.7887 WP_003899382.1.78932 WP_003899382.1.78969 WP_003899382.1.78977 WP_003899382.1.78980 WP_003899382.1.79005 WP_003899382.1.79016 WP_003899382.1.79064 WP_003899382.1.79066 WP_003899382.1.79068 WP_003899382.1.79077 WP_003899382.1.79095 WP_003899382.1.79112 WP_003899382.1.79122 WP_003899382.1.79145 WP_003899382.1.79163 WP_003899382.1.79182 WP_003899382.1.79198 WP_003899382.1.79213 WP_003899382.1.79218 WP_003899382.1.79268 WP_003899382.1.79273 WP_003899382.1.79278 WP_003899382.1.79290 WP_003899382.1.79319 WP_003899382.1.79325 WP_003899382.1.79326 WP_003899382.1.7933 WP_003899382.1.79330 WP_003899382.1.79339 WP_003899382.1.79394 WP_003899382.1.79399 WP_003899382.1.79413 WP_003899382.1.79422 WP_003899382.1.79445 WP_003899382.1.79447 WP_003899382.1.79455 WP_003899382.1.79471 WP_003899382.1.79480 WP_003899382.1.79482 WP_003899382.1.79488 WP_003899382.1.79500 WP_003899382.1.79502 WP_003899382.1.79508 WP_003899382.1.79514 WP_003899382.1.79561 WP_003899382.1.79565 WP_003899382.1.79578 WP_003899382.1.79588 WP_003899382.1.79598 WP_003899382.1.79698 WP_003899382.1.797 WP_003899382.1.79744 WP_003899382.1.79784 WP_003899382.1.79802 WP_003899382.1.79806 WP_003899382.1.79819 WP_003899382.1.79826 WP_003899382.1.79828 WP_003899382.1.79851 WP_003899382.1.79853 WP_003899382.1.79863 WP_003899382.1.79881 WP_003899382.1.79885 WP_003899382.1.79898 WP_003899382.1.7990 WP_003899382.1.79900 WP_003899382.1.79913 WP_003899382.1.79918 WP_003899382.1.79947 WP_003899382.1.79948 WP_003899382.1.7995 WP_003899382.1.7997 WP_003899382.1.80004 WP_003899382.1.80015 WP_003899382.1.80022 WP_003899382.1.80054 WP_003899382.1.80084 WP_003899382.1.80099 WP_003899382.1.80177 WP_003899382.1.80234 WP_003899382.1.8026 WP_003899382.1.80275 WP_003899382.1.8029 WP_003899382.1.80299 WP_003899382.1.80300 WP_003899382.1.80326 WP_003899382.1.80351 WP_003899382.1.8037 WP_003899382.1.80370 WP_003899382.1.80399 WP_003899382.1.8044 WP_003899382.1.80451 WP_003899382.1.80458 WP_003899382.1.80461 WP_003899382.1.80490 WP_003899382.1.80503 WP_003899382.1.80507 WP_003899382.1.80552 WP_003899382.1.80576 WP_003899382.1.80588 WP_003899382.1.80599 WP_003899382.1.8060 WP_003899382.1.80624 WP_003899382.1.80636 WP_003899382.1.80673 WP_003899382.1.80711 WP_003899382.1.80714 WP_003899382.1.80743 WP_003899382.1.80784 WP_003899382.1.80815 WP_003899382.1.80853 WP_003899382.1.80918 WP_003899382.1.8093 WP_003899382.1.80967 WP_003899382.1.8097 WP_003899382.1.80988 WP_003899382.1.81007 WP_003899382.1.81013 WP_003899382.1.8105 WP_003899382.1.81059 WP_003899382.1.81063 WP_003899382.1.81066 WP_003899382.1.81075 WP_003899382.1.81091 WP_003899382.1.81119 WP_003899382.1.81125 WP_003899382.1.81136 WP_003899382.1.8114 WP_003899382.1.81189 WP_003899382.1.81192 WP_003899382.1.812 WP_003899382.1.81230 WP_003899382.1.81249 WP_003899382.1.81250 WP_003899382.1.81264 WP_003899382.1.8128 WP_003899382.1.81287 WP_003899382.1.81297 WP_003899382.1.8138 WP_003899382.1.81407 WP_003899382.1.8143 WP_003899382.1.81439 WP_003899382.1.81465 WP_003899382.1.81505 WP_003899382.1.81529 WP_003899382.1.81538 WP_003899382.1.81541 WP_003899382.1.81561 WP_003899382.1.81567 WP_003899382.1.81712 WP_003899382.1.81720 WP_003899382.1.81731 WP_003899382.1.81774 WP_003899382.1.81788 WP_003899382.1.81809 WP_003899382.1.81820 WP_003899382.1.81850 WP_003899382.1.81883 WP_003899382.1.81891 WP_003899382.1.81911 WP_003899382.1.82011 WP_003899382.1.82048 WP_003899382.1.82069 WP_003899382.1.82071 WP_003899382.1.82108 WP_003899382.1.82136 WP_003899382.1.82142 WP_003899382.1.8215 WP_003899382.1.82158 WP_003899382.1.82209 WP_003899382.1.82210 WP_003899382.1.82228 WP_003899382.1.82236 WP_003899382.1.82251 WP_003899382.1.82271 WP_003899382.1.82305 WP_003899382.1.82317 WP_003899382.1.8232 WP_003899382.1.82346 WP_003899382.1.82374 WP_003899382.1.82385 WP_003899382.1.82429 WP_003899382.1.82460 WP_003899382.1.82462 WP_003899382.1.82483 WP_003899382.1.82494 WP_003899382.1.82531 WP_003899382.1.82546 WP_003899382.1.82547 WP_003899382.1.82549 WP_003899382.1.82577 WP_003899382.1.82592 WP_003899382.1.82597 WP_003899382.1.82598 WP_003899382.1.82625 WP_003899382.1.82642 WP_003899382.1.82653 WP_003899382.1.82681 WP_003899382.1.8271 WP_003899382.1.82712 WP_003899382.1.8273 WP_003899382.1.82774 WP_003899382.1.82803 WP_003899382.1.82860 WP_003899382.1.82871 WP_003899382.1.82935 WP_003899382.1.82957 WP_003899382.1.82973 WP_003899382.1.82983 WP_003899382.1.83004 WP_003899382.1.83009 WP_003899382.1.83044 WP_003899382.1.83065 WP_003899382.1.83110 WP_003899382.1.83146 WP_003899382.1.83149 WP_003899382.1.83159 WP_003899382.1.83173 WP_003899382.1.83181 WP_003899382.1.83182 WP_003899382.1.83197 WP_003899382.1.83212 WP_003899382.1.8326 WP_003899382.1.83262 WP_003899382.1.83273 WP_003899382.1.83309 WP_003899382.1.83332 WP_003899382.1.83334 WP_003899382.1.83341 WP_003899382.1.83349 WP_003899382.1.83353 WP_003899382.1.83367 WP_003899382.1.83380 WP_003899382.1.83381 WP_003899382.1.83389 WP_003899382.1.83408 WP_003899382.1.83409 WP_003899382.1.83435 WP_003899382.1.83470 WP_003899382.1.83524 WP_003899382.1.83526 WP_003899382.1.8358 WP_003899382.1.83601 WP_003899382.1.83611 WP_003899382.1.83638 WP_003899382.1.83648 WP_003899382.1.83656 WP_003899382.1.83667 WP_003899382.1.83689 WP_003899382.1.83692 WP_003899382.1.83705 WP_003899382.1.83766 WP_003899382.1.83793 WP_003899382.1.83794 WP_003899382.1.83802 WP_003899382.1.83805 WP_003899382.1.83842 WP_003899382.1.83850 WP_003899382.1.83861 WP_003899382.1.83884 WP_003899382.1.83920 WP_003899382.1.83929 WP_003899382.1.83930 WP_003899382.1.83975 WP_003899382.1.83991 WP_003899382.1.8400 WP_003899382.1.84027 WP_003899382.1.8404 WP_003899382.1.84070 WP_003899382.1.8409 WP_003899382.1.84146 WP_003899382.1.8415 WP_003899382.1.84176 WP_003899382.1.84186 WP_003899382.1.84192 WP_003899382.1.84228 WP_003899382.1.8424 WP_003899382.1.84244 WP_003899382.1.8426 WP_003899382.1.84277 WP_003899382.1.84287 WP_003899382.1.8434 WP_003899382.1.84388 WP_003899382.1.84408 WP_003899382.1.84409 WP_003899382.1.84438 WP_003899382.1.84460 WP_003899382.1.84488 WP_003899382.1.84504 WP_003899382.1.84620 WP_003899382.1.84623 WP_003899382.1.84666 WP_003899382.1.84670 WP_003899382.1.84739 WP_003899382.1.84766 WP_003899382.1.84774 WP_003899382.1.84812 WP_003899382.1.84836 WP_003899382.1.84839 WP_003899382.1.84846 WP_003899382.1.84873 WP_003899382.1.84938 WP_003899382.1.84968 WP_003899382.1.84973 WP_003899382.1.84981 WP_003899382.1.84985 WP_003899382.1.8503 WP_003899382.1.85038 WP_003899382.1.85041 WP_003899382.1.85043 WP_003899382.1.8505 WP_003899382.1.85074 WP_003899382.1.8509 WP_003899382.1.8512 WP_003899382.1.85148 WP_003899382.1.8518 WP_003899382.1.8522 WP_003899382.1.85242 WP_003899382.1.85276 WP_003899382.1.85281 WP_003899382.1.85284 WP_003899382.1.85319 WP_003899382.1.85330 WP_003899382.1.85346 WP_003899382.1.8535 WP_003899382.1.85363 WP_003899382.1.85371 WP_003899382.1.85377 WP_003899382.1.85387 WP_003899382.1.85399 WP_003899382.1.85458 WP_003899382.1.8546 WP_003899382.1.85464 WP_003899382.1.85478 WP_003899382.1.85480 WP_003899382.1.85495 WP_003899382.1.85551 WP_003899382.1.85557 WP_003899382.1.85577 WP_003899382.1.85597 WP_003899382.1.85599 WP_003899382.1.85610 WP_003899382.1.8563 WP_003899382.1.85648 WP_003899382.1.85679 WP_003899382.1.85704 WP_003899382.1.85727 WP_003899382.1.85737 WP_003899382.1.85763 WP_003899382.1.85808 WP_003899382.1.85819 WP_003899382.1.85820 WP_003899382.1.85823 WP_003899382.1.85832 WP_003899382.1.8586 WP_003899382.1.85872 WP_003899382.1.85909 WP_003899382.1.85953 WP_003899382.1.85986 WP_003899382.1.86000 WP_003899382.1.86024 WP_003899382.1.86025 WP_003899382.1.86032 WP_003899382.1.86052 WP_003899382.1.86067 WP_003899382.1.86103 WP_003899382.1.86122 WP_003899382.1.86124 WP_003899382.1.86160 WP_003899382.1.86164 WP_003899382.1.86168 WP_003899382.1.86190 WP_003899382.1.86204 WP_003899382.1.86208 WP_003899382.1.86235 WP_003899382.1.86249 WP_003899382.1.86260 WP_003899382.1.86290 WP_003899382.1.863 WP_003899382.1.86327 WP_003899382.1.86334 WP_003899382.1.86337 WP_003899382.1.86368 WP_003899382.1.86377 WP_003899382.1.86425 WP_003899382.1.86459 WP_003899382.1.8649 WP_003899382.1.86499 WP_003899382.1.86520 WP_003899382.1.86561 WP_003899382.1.86568 WP_003899382.1.86575 WP_003899382.1.86584 WP_003899382.1.86605 WP_003899382.1.86626 WP_003899382.1.86648 WP_003899382.1.8666 WP_003899382.1.86684 WP_003899382.1.86696 WP_003899382.1.86705 WP_003899382.1.86718 WP_003899382.1.86757 WP_003899382.1.86801 WP_003899382.1.86814 WP_003899382.1.86825 WP_003899382.1.86834 WP_003899382.1.8685 WP_003899382.1.86851 WP_003899382.1.86855 WP_003899382.1.86867 WP_003899382.1.86877 WP_003899382.1.86883 WP_003899382.1.8689 WP_003899382.1.86933 WP_003899382.1.86950 WP_003899382.1.86962 WP_003899382.1.86963 WP_003899382.1.86979 WP_003899382.1.87001 WP_003899382.1.87002 WP_003899382.1.87031 WP_003899382.1.87116 WP_003899382.1.87117 WP_003899382.1.8714 WP_003899382.1.87178 WP_003899382.1.87191 WP_003899382.1.87201 WP_003899382.1.87209 WP_003899382.1.87240 WP_003899382.1.87273 WP_003899382.1.87275 WP_003899382.1.8733 WP_003899382.1.87345 WP_003899382.1.87369 WP_003899382.1.8737 WP_003899382.1.87401 WP_003899382.1.87404 WP_003899382.1.87406 WP_003899382.1.87409 WP_003899382.1.87444 WP_003899382.1.87446 WP_003899382.1.87459 WP_003899382.1.87472 WP_003899382.1.87489 WP_003899382.1.87494 WP_003899382.1.87496 WP_003899382.1.87582 WP_003899382.1.87588 WP_003899382.1.87617 WP_003899382.1.87619 WP_003899382.1.87620 WP_003899382.1.87634 WP_003899382.1.87643 WP_003899382.1.8765 WP_003899382.1.87650 WP_003899382.1.87654 WP_003899382.1.87658 WP_003899382.1.87665 WP_003899382.1.87676 WP_003899382.1.87677 WP_003899382.1.87684 WP_003899382.1.87692 WP_003899382.1.87707 WP_003899382.1.87784 WP_003899382.1.87817 WP_003899382.1.87831 WP_003899382.1.87835 WP_003899382.1.87837 WP_003899382.1.87866 WP_003899382.1.87911 WP_003899382.1.87924 WP_003899382.1.87951 WP_003899382.1.87955 WP_003899382.1.87956 WP_003899382.1.87991 WP_003899382.1.88 WP_003899382.1.88002 WP_003899382.1.88037 WP_003899382.1.88039 WP_003899382.1.88072 WP_003899382.1.88077 WP_003899382.1.88121 WP_003899382.1.88180 WP_003899382.1.88191 WP_003899382.1.88205 WP_003899382.1.88217 WP_003899382.1.88219 WP_003899382.1.88245 WP_003899382.1.88253 WP_003899382.1.88294 WP_003899382.1.88315 WP_003899382.1.88316 WP_003899382.1.88320 WP_003899382.1.88338 WP_003899382.1.88437 WP_003899382.1.88453 WP_003899382.1.88469 WP_003899382.1.88489 WP_003899382.1.88507 WP_003899382.1.88521 WP_003899382.1.88530 WP_003899382.1.88537 WP_003899382.1.88541 WP_003899382.1.88592 WP_003899382.1.88618 WP_003899382.1.8862 WP_003899382.1.88625 WP_003899382.1.88632 WP_003899382.1.88634 WP_003899382.1.88649 WP_003899382.1.8870 WP_003899382.1.88737 WP_003899382.1.88756 WP_003899382.1.88824 WP_003899382.1.88965 WP_003899382.1.88985 WP_003899382.1.8902 WP_003899382.1.89025 WP_003899382.1.89041 WP_003899382.1.89046 WP_003899382.1.89082 WP_003899382.1.89168 WP_003899382.1.8917 WP_003899382.1.89193 WP_003899382.1.89205 WP_003899382.1.89207 WP_003899382.1.89277 WP_003899382.1.89286 WP_003899382.1.89293 WP_003899382.1.89320 WP_003899382.1.8935 WP_003899382.1.89371 WP_003899382.1.89378 WP_003899382.1.89392 WP_003899382.1.89406 WP_003899382.1.89451 WP_003899382.1.89453 WP_003899382.1.89473 WP_003899382.1.89475 WP_003899382.1.89483 WP_003899382.1.895 WP_003899382.1.89513 WP_003899382.1.89517 WP_003899382.1.89522 WP_003899382.1.8954 WP_003899382.1.89543 WP_003899382.1.89567 WP_003899382.1.8957 WP_003899382.1.89572 WP_003899382.1.89589 WP_003899382.1.89607 WP_003899382.1.89613 WP_003899382.1.89625 WP_003899382.1.89648 WP_003899382.1.8967 WP_003899382.1.89670 WP_003899382.1.89676 WP_003899382.1.89729 WP_003899382.1.89739 WP_003899382.1.89762 WP_003899382.1.8977 WP_003899382.1.89808 WP_003899382.1.8982 WP_003899382.1.89829 WP_003899382.1.89831 WP_003899382.1.89844 WP_003899382.1.89849 WP_003899382.1.8989 WP_003899382.1.89901 WP_003899382.1.89903 WP_003899382.1.89909 WP_003899382.1.89926 WP_003899382.1.89963 WP_003899382.1.89971 WP_003899382.1.8998 WP_003899382.1.89987 WP_003899382.1.90048 WP_003899382.1.9007 WP_003899382.1.90080 WP_003899382.1.90130 WP_003899382.1.90134 WP_003899382.1.90137 WP_003899382.1.90157 WP_003899382.1.90199 WP_003899382.1.90231 WP_003899382.1.90245 WP_003899382.1.90308 WP_003899382.1.90322 WP_003899382.1.90328 WP_003899382.1.90372 WP_003899382.1.90439 WP_003899382.1.90481 WP_003899382.1.9050 WP_003899382.1.90527 WP_003899382.1.90550 WP_003899382.1.90560 WP_003899382.1.90612 WP_003899382.1.90640 WP_003899382.1.90672 WP_003899382.1.90687 WP_003899382.1.90691 WP_003899382.1.90711 WP_003899382.1.90722 WP_003899382.1.90744 WP_003899382.1.9075 WP_003899382.1.90756 WP_003899382.1.90767 WP_003899382.1.90785 WP_003899382.1.90788 WP_003899382.1.90800 WP_003899382.1.90810 WP_003899382.1.90816 WP_003899382.1.90819 WP_003899382.1.9082 WP_003899382.1.90884 WP_003899382.1.90899 WP_003899382.1.90906 WP_003899382.1.90958 WP_003899382.1.90977 WP_003899382.1.90987 WP_003899382.1.9102 WP_003899382.1.91026 WP_003899382.1.91032 WP_003899382.1.91043 WP_003899382.1.91106 WP_003899382.1.91112 WP_003899382.1.91144 WP_003899382.1.91151 WP_003899382.1.91157 WP_003899382.1.91167 WP_003899382.1.91169 WP_003899382.1.91192 WP_003899382.1.91201 WP_003899382.1.91207 WP_003899382.1.91208 WP_003899382.1.91211 WP_003899382.1.91214 WP_003899382.1.91230 WP_003899382.1.91244 WP_003899382.1.91251 WP_003899382.1.91260 WP_003899382.1.91265 WP_003899382.1.91284 WP_003899382.1.91294 WP_003899382.1.91303 WP_003899382.1.91322 WP_003899382.1.91352 WP_003899382.1.9139 WP_003899382.1.91398 WP_003899382.1.91430 WP_003899382.1.91436 WP_003899382.1.91483 WP_003899382.1.91496 WP_003899382.1.91507 WP_003899382.1.91576 WP_003899382.1.91589 WP_003899382.1.91694 WP_003899382.1.91713 WP_003899382.1.91716 WP_003899382.1.91717 WP_003899382.1.91728 WP_003899382.1.91743 WP_003899382.1.91759 WP_003899382.1.91784 WP_003899382.1.91785 WP_003899382.1.91786 WP_003899382.1.91802 WP_003899382.1.91822 WP_003899382.1.91828 WP_003899382.1.9189 WP_003899382.1.91896 WP_003899382.1.9190 WP_003899382.1.91915 WP_003899382.1.91931 WP_003899382.1.91944 WP_003899382.1.91953 WP_003899382.1.91957 WP_003899382.1.91976 WP_003899382.1.91978 WP_003899382.1.92021 WP_003899382.1.92083 WP_003899382.1.92150 WP_003899382.1.92153 WP_003899382.1.92190 WP_003899382.1.92192 WP_003899382.1.92200 WP_003899382.1.92220 WP_003899382.1.92221 WP_003899382.1.92222 WP_003899382.1.92273 WP_003899382.1.92289 WP_003899382.1.9229 WP_003899382.1.92294 WP_003899382.1.92300 WP_003899382.1.92317 WP_003899382.1.92334 WP_003899382.1.92338 WP_003899382.1.92356 WP_003899382.1.92364 WP_003899382.1.92380 WP_003899382.1.92428 WP_003899382.1.92447 WP_003899382.1.92456 WP_003899382.1.92467 WP_003899382.1.92471 WP_003899382.1.92508 WP_003899382.1.9251 WP_003899382.1.92511 WP_003899382.1.92523 WP_003899382.1.92527 WP_003899382.1.92536 WP_003899382.1.92592 WP_003899382.1.92597 WP_003899382.1.92603 WP_003899382.1.92606 WP_003899382.1.92610 WP_003899382.1.92613 WP_003899382.1.9263 WP_003899382.1.9265 WP_003899382.1.92650 WP_003899382.1.92660 WP_003899382.1.92685 WP_003899382.1.92689 WP_003899382.1.92690 WP_003899382.1.92714 WP_003899382.1.92736 WP_003899382.1.9274 WP_003899382.1.92760 WP_003899382.1.92777 WP_003899382.1.92833 WP_003899382.1.92856 WP_003899382.1.92892 WP_003899382.1.92907 WP_003899382.1.9291 WP_003899382.1.92917 WP_003899382.1.93006 WP_003899382.1.93009 WP_003899382.1.93015 WP_003899382.1.9307 WP_003899382.1.93083 WP_003899382.1.93097 WP_003899382.1.93137 WP_003899382.1.93192 WP_003899382.1.93199 WP_003899382.1.93203 WP_003899382.1.93212 WP_003899382.1.93234 WP_003899382.1.93245 WP_003899382.1.93257 WP_003899382.1.93265 WP_003899382.1.93297 WP_003899382.1.93320 WP_003899382.1.93328 WP_003899382.1.93343 WP_003899382.1.93349 WP_003899382.1.93363 WP_003899382.1.93377 WP_003899382.1.9338 WP_003899382.1.93407 WP_003899382.1.93417 WP_003899382.1.93419 WP_003899382.1.93426 WP_003899382.1.9344 WP_003899382.1.93443 WP_003899382.1.93447 WP_003899382.1.93470 WP_003899382.1.93483 WP_003899382.1.93487 WP_003899382.1.93495 WP_003899382.1.93499 WP_003899382.1.93516 WP_003899382.1.93536 WP_003899382.1.93544 WP_003899382.1.93555 WP_003899382.1.93560 WP_003899382.1.93564 WP_003899382.1.9357 WP_003899382.1.93573 WP_003899382.1.93576 WP_003899382.1.9363 WP_003899382.1.93645 WP_003899382.1.93649 WP_003899382.1.93659 WP_003899382.1.93677 WP_003899382.1.9368 WP_003899382.1.93689 WP_003899382.1.93693 WP_003899382.1.93698 WP_003899382.1.93706 WP_003899382.1.9371 WP_003899382.1.93792 WP_003899382.1.93823 WP_003899382.1.93871 WP_003899382.1.9388 WP_003899382.1.93894 WP_003899382.1.93903 WP_003899382.1.93907 WP_003899382.1.93913 WP_003899382.1.93946 WP_003899382.1.93950 WP_003899382.1.93953 WP_003899382.1.93954 WP_003899382.1.93988 WP_003899382.1.9407 WP_003899382.1.94143 WP_003899382.1.94154 WP_003899382.1.94204 WP_003899382.1.94205 WP_003899382.1.94226 WP_003899382.1.94231 WP_003899382.1.94256 WP_003899382.1.94261 WP_003899382.1.94281 WP_003899382.1.94297 WP_003899382.1.9431 WP_003899382.1.94326 WP_003899382.1.94339 WP_003899382.1.94392 WP_003899382.1.94416 WP_003899382.1.94421 WP_003899382.1.94456 WP_003899382.1.94480 WP_003899382.1.94495 WP_003899382.1.94511 WP_003899382.1.94512 WP_003899382.1.94528 WP_003899382.1.94564 WP_003899382.1.946 WP_003899382.1.94602 WP_003899382.1.94623 WP_003899382.1.94629 WP_003899382.1.9465 WP_003899382.1.94673 WP_003899382.1.94714 WP_003899382.1.94730 WP_003899382.1.94736 WP_003899382.1.9478 WP_003899382.1.94834 WP_003899382.1.94852 WP_003899382.1.94872 WP_003899382.1.94902 WP_003899382.1.94916 WP_003899382.1.94979 WP_003899382.1.94994 WP_003899382.1.94996 WP_003899382.1.94998 WP_003899382.1.95007 WP_003899382.1.95010 WP_003899382.1.95015 WP_003899382.1.95034 WP_003899382.1.95068 WP_003899382.1.95081 WP_003899382.1.95082 WP_003899382.1.9509 WP_003899382.1.95112 WP_003899382.1.95138 WP_003899382.1.9514 WP_003899382.1.95179 WP_003899382.1.95234 WP_003899382.1.95241 WP_003899382.1.95245 WP_003899382.1.95257 WP_003899382.1.95279 WP_003899382.1.9531 WP_003899382.1.95335 WP_003899382.1.95344 WP_003899382.1.9535 WP_003899382.1.95370 WP_003899382.1.95392 WP_003899382.1.95416 WP_003899382.1.95417 WP_003899382.1.95454 WP_003899382.1.95491 WP_003899382.1.95497 WP_003899382.1.95508 WP_003899382.1.95509 WP_003899382.1.95529 WP_003899382.1.95556 WP_003899382.1.95557 WP_003899382.1.95565 WP_003899382.1.95578 WP_003899382.1.95580 WP_003899382.1.95585 WP_003899382.1.95679 WP_003899382.1.95685 WP_003899382.1.957 WP_003899382.1.95724 WP_003899382.1.95727 WP_003899382.1.95730 WP_003899382.1.95735 WP_003899382.1.95758 WP_003899382.1.95772 WP_003899382.1.95839 WP_003899382.1.9585 WP_003899382.1.9590 WP_003899382.1.95902 WP_003899382.1.95924 WP_003899382.1.95926 WP_003899382.1.95953 WP_003899382.1.95958 WP_003899382.1.95964 WP_003899382.1.95973 WP_003899382.1.96006 WP_003899382.1.9602 WP_003899382.1.96036 WP_003899382.1.96065 WP_003899382.1.96098 WP_003899382.1.96146 WP_003899382.1.96166 WP_003899382.1.96171 WP_003899382.1.96182 WP_003899382.1.96230 WP_003899382.1.96235 WP_003899382.1.96242 WP_003899382.1.96245 WP_003899382.1.96254 WP_003899382.1.96259 WP_003899382.1.96286 WP_003899382.1.96313 WP_003899382.1.96318 WP_003899382.1.96345 WP_003899382.1.96360 WP_003899382.1.96373 WP_003899382.1.96456 WP_003899382.1.96486 WP_003899382.1.96569 WP_003899382.1.96573 WP_003899382.1.96575 WP_003899382.1.96576 WP_003899382.1.96611 WP_003899382.1.96621 WP_003899382.1.9667 WP_003899382.1.96681 WP_003899382.1.96726 WP_003899382.1.96733 WP_003899382.1.96742 WP_003899382.1.96754 WP_003899382.1.9678 WP_003899382.1.96832 WP_003899382.1.9685 WP_003899382.1.97008 WP_003899382.1.97009 WP_003899382.1.97056 WP_003899382.1.97084 WP_003899382.1.97087 WP_003899382.1.97094 WP_003899382.1.97096 WP_003899382.1.97099 WP_003899382.1.97108 WP_003899382.1.97113 WP_003899382.1.97122 WP_003899382.1.97127 WP_003899382.1.9716 WP_003899382.1.97222 WP_003899382.1.97223 WP_003899382.1.97242 WP_003899382.1.97270 WP_003899382.1.97283 WP_003899382.1.97296 WP_003899382.1.97321 WP_003899382.1.97325 WP_003899382.1.97366 WP_003899382.1.97376 WP_003899382.1.97380 WP_003899382.1.9739 WP_003899382.1.97462 WP_003899382.1.97517 WP_003899382.1.97519 WP_003899382.1.97535 WP_003899382.1.97540 WP_003899382.1.97545 WP_003899382.1.97546 WP_003899382.1.97584 WP_003899382.1.9759 WP_003899382.1.97591 WP_003899382.1.97609 WP_003899382.1.97618 WP_003899382.1.9763 WP_003899382.1.97669 WP_003899382.1.97673 WP_003899382.1.97700 WP_003899382.1.97701 WP_003899382.1.9773 WP_003899382.1.97730 WP_003899382.1.97740 WP_003899382.1.97751 WP_003899382.1.97754 WP_003899382.1.9782 WP_003899382.1.9784 WP_003899382.1.97888 WP_003899382.1.9790 WP_003899382.1.9795 WP_003899382.1.97951 WP_003899382.1.97958 WP_003899382.1.97966 WP_003899382.1.97977 WP_003899382.1.97979 WP_003899382.1.97995 WP_003899382.1.98018 WP_003899382.1.98034 WP_003899382.1.98052 WP_003899382.1.98071 WP_003899382.1.98072 WP_003899382.1.98113 WP_003899382.1.98114 WP_003899382.1.98128 WP_003899382.1.98181 WP_003899382.1.98188 WP_003899382.1.98189 WP_003899382.1.98213 WP_003899382.1.98225 WP_003899382.1.98291 WP_003899382.1.98335 WP_003899382.1.98350 WP_003899382.1.98395 WP_003899382.1.98412 WP_003899382.1.98441 WP_003899382.1.98443 WP_003899382.1.98462 WP_003899382.1.9848 WP_003899382.1.98482 WP_003899382.1.98486 WP_003899382.1.98488 WP_003899382.1.98503 WP_003899382.1.98516 WP_003899382.1.98524 WP_003899382.1.98536 WP_003899382.1.98541 WP_003899382.1.98566 WP_003899382.1.98576 WP_003899382.1.98590 WP_003899382.1.98594 WP_003899382.1.98599 WP_003899382.1.98629 WP_003899382.1.98645 WP_003899382.1.98656 WP_003899382.1.9867 WP_003899382.1.98674 WP_003899382.1.98697 WP_003899382.1.98701 WP_003899382.1.98739 WP_003899382.1.98749 WP_003899382.1.98765 WP_003899382.1.98770 WP_003899382.1.98777 WP_003899382.1.98778 WP_003899382.1.98802 WP_003899382.1.98838 WP_003899382.1.98850 WP_003899382.1.98906 WP_003899382.1.98935 WP_003899382.1.98948 WP_003899382.1.98984 WP_003899382.1.99023 WP_003899382.1.99030 WP_003899382.1.99055 WP_003899382.1.99062 WP_003899382.1.99086 WP_003899382.1.99115 WP_003899382.1.99117 WP_003899382.1.99161 WP_003899382.1.99176 WP_003899382.1.99205 WP_003899382.1.99211 WP_003899382.1.99216 WP_003899382.1.99222 WP_003899382.1.99251 WP_003899382.1.99294 WP_003899382.1.99312 WP_003899382.1.99315 WP_003899382.1.99322 WP_003899382.1.99328 WP_003899382.1.99365 WP_003899382.1.99368 WP_003899382.1.99396 WP_003899382.1.99402 WP_003899382.1.99404 WP_003899382.1.99419 WP_003899382.1.99438 WP_003899382.1.99460 WP_003899382.1.99468 WP_003899382.1.99513 WP_003899382.1.99529 WP_003899382.1.99548 WP_003899382.1.99572 WP_003899382.1.99575 WP_003899382.1.99578 WP_003899382.1.99609 WP_003899382.1.99617 WP_003899382.1.99635 WP_003899382.1.99650 WP_003899382.1.99672 WP_003899382.1.99701 WP_003899382.1.99711 WP_003899382.1.99716 WP_003899382.1.99740 WP_003899382.1.99745 WP_003899382.1.99749 WP_003899382.1.9976 WP_003899382.1.99798 WP_003899382.1.99817 WP_003899382.1.99832 WP_003899382.1.99847 WP_003899382.1.99852 WP_003899382.1.99886 WP_003899382.1.99897 WP_003899382.1.99899 WP_003899382.1.99915 WP_003899382.1.9993 WP_003899382.1.99982 gi|15609709|ref|NP_217088.1| gi|525675123|ref|YP_008226666.1| gi|506927109|ref|YP_008007559.1| gi|375295612|ref|YP_005099879.1| gi|385999352|ref|YP_005917651.1| gi|148823767|ref|YP_001288521.1| gi|544161928|ref|YP_008537748.1| gi|392387209|ref|YP_005308838.1| gi|15609709|ref|NP_217088.1| 336982.TBFG_12592 419947.MRA_2601 478434.TBMG_01401 83332.Rv2572c gi|392431818|ref|YP_006472862.1| gi|479056534|ref|YP_007352340.1| gi|471338578|ref|YP_007611291.1| gi|506927109|ref|YP_008007559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]