SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284989566|ref|YP_003408120.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284989566|ref|YP_003408120.1|
Domain Number 1 Region: 7-127
Classification Level Classification E-value
Superfamily FlgN-like 0.000000000183
Family FlgN-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284989566|ref|YP_003408120.1|
Sequence length 164
Comment FlgN family protein [Geodermatophilus obscurus DSM 43160]
Sequence
MGGVDYQLLSTLLWREQELLDLLLFKAEEKQYLIVTGKTRWLSRIAHEIEVVLDQLRTIE
VERAAATEVIAERLGVGVNPSLRKLAEAAPTPWNDLYAKHHETLLALVTELRGLSDANRE
LIEGGLSAFGDALLSVKAPSAGTYGATGRSDQRAHRAVTLDGAL
Download sequence
Identical sequences D2S9N6
WP_012947190.1.76031 gi|284989566|ref|YP_003408120.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]