SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284989567|ref|YP_003408121.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284989567|ref|YP_003408121.1|
Domain Number 1 Region: 153-475
Classification Level Classification E-value
Superfamily Phase 1 flagellin 6.8e-18
Family Phase 1 flagellin 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284989567|ref|YP_003408121.1|
Sequence length 482
Comment flagellar hook-associated protein FlgK [Geodermatophilus obscurus DSM 43160]
Sequence
MSSTFGGLNTARTALWASQRGLDVTGQNIANVNTDGYSRQRVELRAMGGTAVPAIHSVSS
PVGNGVDANQVDRIRDVFLERRGQVETARTAQLTVGNEALAQVEAAFREPGETGIRSMLD
DVWAGFSALANATDPTEPAVRSQVLERLDILASGMRTTRATLDQQWRQTRDNVVALAAEV
NTTASSIADLNTQIRQATRSGLPTNELSDRRDLLVVQLAEKVGATSVAASDGMVDVIVGG
TTLVAGGSALGLRVAGVDDPDAVGAGNDPRVVTAPGGTTLAVGGTAGGQMAVLSTTLPSY
RNALDGLARDLVGKINAVQAQGYDVYGASGAAEPLMDDGSGNPVVDLANVDAGNIRVRVT
RPELIAAATTAPGVLGAPSADGGNADAFFDLSLENGGVDATYRALVVALGVEASVVARDV
AVQKVISTQVDAARESVSGVNLDEEMTNMLSFQHAYSAAARMVTAIDEALDTLINRTGVV
GR
Download sequence
Identical sequences D2S9N7
WP_012947191.1.76031 gi|284989567|ref|YP_003408121.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]