SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284989751|ref|YP_003408305.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284989751|ref|YP_003408305.1|
Domain Number 1 Region: 9-55,197-443
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.48e-58
Family Bacterial dinuclear zinc exopeptidases 0.0000147
Further Details:      
 
Domain Number 2 Region: 84-193
Classification Level Classification E-value
Superfamily PA domain 0.000000000000405
Family PA domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284989751|ref|YP_003408305.1|
Sequence length 481
Comment Aminopeptidase Y [Geodermatophilus obscurus DSM 43160]
Sequence
MTAAAVPPGKVLEHLEVFQAIANANNGNRASGTSGYRGSVDYVVGRLRAAGYAPRVQNFS
FPFFQEVSPATVSAGGRQLAAEDVAVMTYSGSGTVTAPVQAVGTTGERAASTSGCEAGDF
ADFVPGNIALLQRGTCAFGVKAANAAAAGASAVLIFNTGLPGAEGAVAGTLGEPGVTTVP
AVGLSYTAGVALLRGGEVTVSTQTVSESRETSNVLAETRSGDPERTVMVGAHLDSVPQGP
GINDNASGSAGILAIAEMLAGTETANAVRFAWWGAEEFGLLGSRHYVADLKTNDPATLGN
VALYLNFDMIGSPNHGRFVYDGDASAFGPDDGSVPAPAGSAVIEAAFHEHFGSLGLASGE
TEFSGRSDYGPFIAEGIASGGLFTGAEGIKTVEQAALFGGRAGIGYDFCYHASCDDLSNI
DHRTLDEMTGAASAVILRFANSPLGLEEEGRRLLAAVAPVPAATVDQGHGPSNAAEARQP
R
Download sequence
Identical sequences D2SAK5
WP_012947375.1.76031 gi|284989751|ref|YP_003408305.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]