SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284990282|ref|YP_003408836.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284990282|ref|YP_003408836.1|
Domain Number 1 Region: 521-828
Classification Level Classification E-value
Superfamily Aldolase 3.85e-75
Family HMGL-like 0.00000101
Further Details:      
 
Domain Number 2 Region: 84-362
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 7.25e-70
Family BC ATP-binding domain-like 0.00000553
Further Details:      
 
Domain Number 3 Region: 825-990
Classification Level Classification E-value
Superfamily post-HMGL domain-like 9.81e-41
Family Conserved carboxylase domain 0.0035
Further Details:      
 
Domain Number 4 Region: 1-112
Classification Level Classification E-value
Superfamily PreATP-grasp domain 7.91e-40
Family BC N-terminal domain-like 0.0000569
Further Details:      
 
Domain Number 5 Region: 334-451
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 3.3e-38
Family BC C-terminal domain-like 0.0000768
Further Details:      
 
Domain Number 6 Region: 1048-1123
Classification Level Classification E-value
Superfamily Single hybrid motif 6.02e-17
Family Biotinyl/lipoyl-carrier proteins and domains 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284990282|ref|YP_003408836.1|
Sequence length 1124
Comment pyruvate carboxylase [Geodermatophilus obscurus DSM 43160]
Sequence
MFTKVLVANRGEIAVRAFRATYELGAQTVAIFPWEDRNSVHRLKADESYQIGEEGHPVRA
YLSVDEVVGAARRAGADAVYPGYGFLSENPELAAACEREGITFVGPPASVLELTGNKARA
IAAAREAGLPVLASTAPSDDLDTVLASTADMPFPVFVKAVAGGGGRGMRRVEDPAELAGA
VQAAMREAESAFGDATVFVEQAVVEPRHIEVQVLADGQGNVVHLFERDCSVQRRHQKVIE
LAPAPNLDPHLRERICADAVAFARAIGYVNAGTVEFLLDREGRHVFIEMNPRIQVEHTVT
EEVTDVDLVQSQLRIAAGETLADLGLSQESIVLRGAALQCRITTEDPANGFRPDTGRITA
YRSPGGAGIRLDGGASLGAEVQAHFDSLLVKLTCRGRTFDIAVARARRAVAEFRIRGVAT
NIPFLAAVLDDPDFAAGRVTTSFIEERPELLTARSSADRGTRLLTYLADVTVNHPHGERP
HLVDPVSKLPAVDLTVPPPDGSRQRLLAAGPEAFAADLRARTALAVTDTTFRDAHQSLLA
TRVRTRDLLAVAGHVARTAPQLFSLECWGGATYDVALRFLHEDPWDRLAALRDAVPNICL
QMLLRGRNTVGYTPYPEAVTDAFVREAAATGIDVFRVFDALNDVAQMRPAIDAVRETGTA
VAEVALCYTGDLSDPGEDLYTLDYYLRLAEQIVDAGAHVLAIKDMAGLLRPPAAATLVMA
LRERFDLPVHLHTHDTAGGQLATLLAAWNAGVDAVDGAVASMAGTTSQPPLSAIVAATDA
TERATGLDLAAVNDLEPYWEAVRRVYAPFESGLAAPTGRVYRHEIPGGQLSNLRQQAIAL
GLGQRFEEVEDAYAAADRLLGRLVKVTPSSKVVGDLALQLVGSGVSVEDFAAEPGKYDLP
DSVIGFLRGELGDPPGGWPEPFRSRALEGRRPAEPPAELSAEDERGLAEQPRQTLNRLLF
PGPTREYEAHVDSYGDVSVLPTKEFLYGLRPGDEHAVDLEPGVTLLVGVEAVSDPDERGM
RTVMCTLNGQLRPVSVRDRSVDAQVKAAEKADRSDPGQVAAPFAGVVTLQVGEGDTVEAG
QPIATIEAMKMEASITAPVAGTVKRLAIGGVQQVEGGDLLVVLS
Download sequence
Identical sequences D2SDL2
WP_012947905.1.76031 gi|284990282|ref|YP_003408836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]