SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284991736|ref|YP_003410290.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284991736|ref|YP_003410290.1|
Domain Number 1 Region: 11-274
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.72e-75
Family Protein kinases, catalytic subunit 0.00000163
Further Details:      
 
Domain Number 2 Region: 601-656
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000563
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|284991736|ref|YP_003410290.1|
Sequence length 661
Comment PASTA sensor-containing serine/threonine protein kinase [Geodermatophilus obscurus DSM 43160]
Sequence
MTDPVVGLVLEGRYLLEERLARGGMSTVYAATDLRLHRTVAVKVMAEHLAHDPTFVDRFT
REARAAAMLSHPNVVSVSDQGSDQGLVFLVMELVRGRTLRDLLQARGRLTVAEAFAVLEP
VLSGLTAAHRAGIVHRDIKPENVLIGADGVVKVADFGLARALTGTGQTSHTGGVLIGTVA
YLSPEQLERGKADARSDVYAAGVVLFEMLTGHPPYGGDTPLAVAYQHVHHDMPRPSEEVP
GLPWEVDELVARTTRREPAVRPLDAGAFLADLEDVRNDLSIERVPVPTGRSTGGPEVLRP
TNRPSRPTRHTGDPAAPRTEVLGPGGTRPGRGNRTSMLPGTVGGAAPDAGGRRPAPTRPR
PGVPAHIRRRRARLAVALVLLTAITIGAVGWWLGSGRWTTVPQLTGREQATAIDLLQEAG
LDPDCCEEQFSEDVPDGVVISAQPEGGEAIRGTDVRLVVSKGPERFEAPPDLVGQPLDAV
RAALENVPVATREVQDYDDDIPVGHVTGFKPEAGTELKRDEELVVYVSRGHAPVPVPAVV
GLSPEQATANLDTLGFTVERSEGRSADVDPGEVMAVSPAAGQQAPYRSTVTLQVSAGLPQ
VQVPDVVGRSQQEAAALLQQAGLQVQVNQFFGDRVIRQSPAAGQTVDIGTSVTILLSFGQ
D
Download sequence
Identical sequences D2SAA4
gi|284991736|ref|YP_003410290.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]