SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|284992018|ref|YP_003410572.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284992018|ref|YP_003410572.1|
Domain Number 1 Region: 8-161
Classification Level Classification E-value
Superfamily RraA-like 2.88e-44
Family RraA-like 0.00000981
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|284992018|ref|YP_003410572.1|
Sequence length 164
Comment regulator of ribonuclease activity A [Geodermatophilus obscurus DSM 43160]
Sequence
MTEPRVPATTDVCDAHPEAQVCEPVFEVFGGRAAFSGPITTLKVFEDNTLVKQAVEGPGE
GRVLVVDGGGSRRCGLVGGNLAVSAATNGWAGIVVYGCIRDADELAEQPIGVRALAAHPR
RSERGMHSGQAGRPVVFAGVVFREGEWLCADRDGVVVLPAAPEG
Download sequence
Identical sequences D2SBU4
WP_012949626.1.76031 gi|284992018|ref|YP_003410572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]