SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|284992856|ref|YP_003411410.1| from Geodermatophilus obscurus DSM 43160

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|284992856|ref|YP_003411410.1|
Domain Number 1 Region: 1-59
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 5.62e-22
Family Ribosomal protein L30p/L7e 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|284992856|ref|YP_003411410.1|
Sequence length 60
Comment 50S ribosomal protein L30 [Geodermatophilus obscurus DSM 43160]
Sequence
MAQLKVTQIRSAIGTKPNQRQTLRSLGLKRVNDSVVQEDRPEIRGMVATVPHLVTVEEIS
Download sequence
Identical sequences D2SH85
gi|284992856|ref|YP_003411410.1| WP_012950464.1.76031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]