SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269123154|ref|YP_003305731.1| from Streptobacillus moniliformis DSM 12112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269123154|ref|YP_003305731.1|
Domain Number 1 Region: 193-585
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.88e-86
Family beta-Lactamase/D-ala carboxypeptidase 0.00012
Further Details:      
 
Domain Number 2 Region: 58-247
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 7.46e-20
Family Penicillin binding protein dimerisation domain 0.0076
Further Details:      
 
Domain Number 3 Region: 618-669
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000000772
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269123154|ref|YP_003305731.1|
Sequence length 670
Comment peptidoglycan glycosyltransferase [Streptobacillus moniliformis DSM 12112]
Sequence
MSKLDRWFLKEKNRKKIYFTFFLLFLFLIIVRLFFLQILHKDFSFNVINPIRSYVKEIRA
KRGSIITSDNLELAVDLEYQGIVVDPTLFKDREEIEKFVNIINKVIKNIKIEETVDKIFE
LKEKNKKYYEFKNVLINVDQKDQIDELIKEARKNDRETFNARFVYFTRKFKREYINSSVF
ETIVGFINKEEKGVYGVEHKYDEMLKGENGQATGTAPFSASLAEYTLPYLIDEKIVKNAK
DGNDIVLTIDSLLQYSLDDILKDAHEKFEATTTMGIVMESDTGKIVAMSSYPKASNRAEI
KNHNITSLFEPGSIFKPLTVAMAMNEGLINENTLIHSEGYIKVKNRIIRDHDDSTKGTLP
VSKIMVNSGNVGLVKISQMMNPETFYNYLPKFGLGEKTGIDISYETVSSLINPKDFTEVR
RSNVSFGQGINMTQLQMLVALNATINGGELITPQIVEKIVGSDGKIVKNFEIHNKGKVIN
ENVSAKIRKILEEVVSSGTGRGIKLDGYRIGGKTGTAQKAGPKGYEAGKYFSSFFTFFPA
DKPKYSILITVDEPHGQYYGAAVALPLARDILDKIIKYKDVTPSEKVVQNISAIEIATPK
ENRNNKIENIKNDFSMDIMPNLIGVTKKNLLELGIDRYSVFMTGNGKVVKQYPEAGSKIK
VGDKIRLELK
Download sequence
Identical sequences D1AX28
gi|269123154|ref|YP_003305731.1| 519441.Smon_0370 WP_012858411.1.14448 WP_012858411.1.29480 WP_012858411.1.36664 WP_012858411.1.40525 WP_012858411.1.54298 WP_012858411.1.57556 WP_012858411.1.60729 WP_012858411.1.82586 WP_012858411.1.85210 WP_012858411.1.97608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]