SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269123409|ref|YP_003305986.1| from Streptobacillus moniliformis DSM 12112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269123409|ref|YP_003305986.1|
Domain Number 1 Region: 2-195
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.65e-43
Family PP-loop ATPase 0.00015
Further Details:      
 
Domain Number 2 Region: 318-379
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000392
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269123409|ref|YP_003305986.1|
Sequence length 397
Comment tRNA(Ile)-lysidine synthetase [Streptobacillus moniliformis DSM 12112]
Sequence
MFRNFIERNKLIEKNDKILIAFSAGPDSVFLLEKLLEIKDEYNLQLHLGYVNHNFRDDVH
KDMELVKKIANKYNLEYSILDIKLEKFTEEKARELRYSALSDLKKRIKFTKIATGHNKTD
NAETIIFRIIRGTGLDGLEGIRIKRDDIIRPILYISKDEILKQVYNEYVIDKTNLENNYS
RNKIRNLVFPILAEINSKYIDNIVKIHKNIININDEKYEYILNKLNEKNISLNTKKIEQI
YNILDKNESKIIDLGNEYIWYKSYDNNKILKKIELEKKPTNTVLTLNNEVEFNGFKVGYV
ASTRLEKISNKMYNILSLDTFDEHSTFIIRTRIDGDRLDNKKLKKLFIDQKIDKLERDKM
PIVLYGNSVILAGDSFKTRKKGSINKYYLYIRRNYGR
Download sequence
Identical sequences D1AXT3
519441.Smon_0631 gi|269123409|ref|YP_003305986.1| WP_012858661.1.29480 WP_012858661.1.60729 WP_012858661.1.97608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]