SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269123958|ref|YP_003306535.1| from Streptobacillus moniliformis DSM 12112

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|269123958|ref|YP_003306535.1|
Domain Number - Region: 178-239
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.019
Further Details:      
 
Domain Number - Region: 41-102
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00736
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.022
Further Details:      
 
Domain Number - Region: 107-168
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00746
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|269123958|ref|YP_003306535.1|
Sequence length 290
Comment PASTA domain-containing protein [Streptobacillus moniliformis DSM 12112]
Sequence
MFNKSIYNKVIKISIIILSLLIILTLGRSAFLNYFFNKRETIVPKVTALHIDDAKKLLED
FNLKYSIIEYKSSEVPEDYVFIQDPKPESKVKVNRTVNIWVNKINSVEIPDLKGKTLIEA
RRILEEFNIQIVRIDYMPVEDIDEEIVLSIYPKVGSKIGTNQKVSLLVSSKSLIESKVMP
NLIGLDKNDAANILAQIGQSIALVTEANDPAFAQNVIITTNPLPGENIEKDTKISVVLNT
GVEVDKSITEVLEQKVESKKLDSNIEEILNKTLKEVEKKEANKENRAKGE
Download sequence
Identical sequences D1AV98
519441.Smon_1203 WP_012859205.1.14448 WP_012859205.1.21118 WP_012859205.1.22774 WP_012859205.1.29480 WP_012859205.1.36664 WP_012859205.1.44000 WP_012859205.1.60729 WP_012859205.1.66514 WP_012859205.1.82586 WP_012859205.1.85210 WP_012859205.1.98509 gi|269123958|ref|YP_003306535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]