SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269124007|ref|YP_003306584.1| from Streptobacillus moniliformis DSM 12112

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269124007|ref|YP_003306584.1|
Domain Number 1 Region: 200-390
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.02e-65
Family B3/B4 domain of PheRS, PheT 0.000018
Further Details:      
 
Domain Number 2 Region: 464-699
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.98e-44
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0004
Further Details:      
 
Domain Number 3 Region: 39-193
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.71e-44
Family Myf domain 0.0063
Further Details:      
 
Domain Number 4 Region: 708-805
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.44e-27
Family Anticodon-binding domain of PheRS 0.0014
Further Details:      
 
Domain Number 5 Region: 401-472
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000011
Family Domains B1 and B5 of PheRS-beta, PheT 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269124007|ref|YP_003306584.1|
Sequence length 806
Comment phenylalanyl-tRNA synthetase subunit beta [Streptobacillus moniliformis DSM 12112]
Sequence
MLISLNWLREYIDLDKNIDIKELENALTMIGQEVEKIEKQGEHLTKVLTAKVLEKIPHPN
SDHISICQVDNGEKVQQVLCGAPNHKVGDIVAMAQIGAELEEGFVIKKAKIRGEESNGML
CSEAELKIGKDHDGIMILPQDTKLGIPLNEYLGLDDIIFELEITPNRPDCLSHIGIAREL
AAYYSKKLRLPEVNVNVEDREDIDISIEEGLSNRYLARVIKGVKVEKSPEWLKNRLEAVG
IRSINNIVDISNYVMLETNQPNHIFDFNKFNSKKVTITKAKDDEKFVTLDQKERILNNED
IVIGNGEKTVALAGVMGGMDVEVDENSTDILIEVAHFDNIMVRKTNRKFALSTEAAYRFE
RAVNTENMEYVMNRITSLIKEIAGGKVCNINDNYPVKPEIKVSTLSLPRLYRFIGKEIEK
DKILDIFEKLEIKIEDKGDEILLTAPSHRQDLINQFDYFEEVIRMVGFDSIENVMPSVNL
TKERLEDTTRFVTDIKKIVSNLGMREVINYSFIPKNSLEKILFEIHSDNIIEIKNPIVEE
FSILRPTLMYSLIKNVRDNINRGATDIRFFEVSKRFTKESTNKVNEKSVLIDEMQVFEKE
TLALILSGSKIKNIWNAKPENYDFYDLKGVVEAIFEKLKFTKYQIRRSENKAYHPGRSVD
VFVGKELIASYGELHPDVLENMDVEKNNILYAEIYLDLIKKYISNNVKYKGLSKYQSVPR
DIALVVNENVLVGDMIKTIEKIDNLIEKVELFDIYQGLGIEKGYKSVAISIIMRDDNKTL
EEKEINDIMTKIINKLNKDFGAVLRG
Download sequence
Identical sequences D1AVE7
gi|269124007|ref|YP_003306584.1| WP_012859253.1.12341 WP_012859253.1.14448 WP_012859253.1.22774 WP_012859253.1.29480 WP_012859253.1.36664 WP_012859253.1.44000 WP_012859253.1.49772 WP_012859253.1.52956 WP_012859253.1.54298 WP_012859253.1.57354 WP_012859253.1.57556 WP_012859253.1.85210 519441.Smon_1254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]