SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294142842|ref|YP_003558820.1| from Shewanella violacea DSS12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294142842|ref|YP_003558820.1|
Domain Number 1 Region: 635-787
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.77e-27
Family Histidine kinase 0.01
Further Details:      
 
Domain Number 2 Region: 565-634
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000608
Family Homodimeric domain of signal transducing histidine kinase 0.0064
Further Details:      
 
Weak hits

Sequence:  gi|294142842|ref|YP_003558820.1|
Domain Number - Region: 348-397
Classification Level Classification E-value
Superfamily HAMP domain-like 0.000109
Family HAMP domain 0.008
Further Details:      
 
Domain Number - Region: 413-520
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000228
Family Heme-binding PAS domain 0.074
Further Details:      
 
Domain Number - Region: 64-170
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00759
Family Apolipoprotein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294142842|ref|YP_003558820.1|
Sequence length 791
Comment phosphoglycerate transport regulatory protein PgtB [Shewanella violacea DSS12]
Sequence
MKLFNYHTIGSKLVLAFAGCSLLITIISAVALTTWNNLDNHVSTILDSSVPTLNTSYQLE
SHSAQLQALIAKIQASTNKAEHNKLKLLLDKELTKITKRVNHLRSNPDTSELNFGYAKLA
NDIDNLERQLLKRIDNQREIDSIKEKIHWIHQDIRDELLPLRQELQWQLTRVNLKHDPKG
QRNNIADEFSTTQSLMDKESRVYEQIIELIATQHGSQIDNAFEVINYKLMDIHSLSESIF
YHSSTIAYRQLLGELTKIMRPKEMLRQRLHNKLQLETKIDQANVSIQSQLAQQHKQIRNM
VANAAQTLKIVKLNIKQTISYSNRLLIICFSISIGISLFLTLYFIRNRIINRLNQLSESL
SDINEGKLDLDIKVSGTDEIGQIGELLRQFCLQMREMEKTNALNLINNTQASIITCDLFG
KIESVNPSARQLFELPVSGELNMVWDCFSSPDIQELQSQFSEVGSLLDTGSGSVTLFIAA
DTSVLTPAYLKLDLHLFKQGHQQKVIITISDITEHIETKHILEMHVNEKTQSLTQANKEL
IAEVELHRRTEKNLRDTQTELIQAAKMAVVGQAMTCTAHELNQPLSAISTYLFSAQMALD
KHEYDSLPNALKKIELLSIRMSKIVQNLRNFAKKNPADSPLIQIELHDIAEQARAIVITK
AKRQQTKITNHLPIGIYTQADGIQLEQIIINLLVNSCDAVASSKIREIDIIYLGSNNESH
TLAILDSGHGLEPEILTSLFTPFTTTKELGLGLGLSISQAIIERFHGAIIPASGLTGGAM
LILELPQYDNK
Download sequence
Identical sequences D4ZDY1
gi|294142842|ref|YP_003558820.1| WP_013053333.1.44054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]