SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383490264|ref|YP_005407940.1| from Synechocystis sp. PCC 6803 substr. PCC-N

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383490264|ref|YP_005407940.1|
Domain Number 1 Region: 3-319
Classification Level Classification E-value
Superfamily FMN-binding split barrel 2.47e-111
Family UbiD middle domain-like 0.000000119
Further Details:      
 
Domain Number 2 Region: 320-484
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 7.06e-56
Family UbiD C-terminal domain-like 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|383490264|ref|YP_005407940.1|
Sequence length 501
Comment hypothetical protein SYNPCCN_0301 [Synechocystis sp. PCC 6803 substr. PCC-N]
Sequence
MARDLRGFIQLLETRGQLRRITAEVDPDLEVAEISNRMLQAGGPGLLFENVKGSPFPVAV
NLMGTVERICWAMNMDHPLELEDLGKKLALLQQPKPPKKISQAIDFGKVLFDVLKAKPGR
NFFPPCQEVVIDGENLDLNQIPLIRPYPGDAGKIITLGLVITKDCETGTPNVGVYRLQLQ
SKTTMTVHWLSVRGGARHLRKAAEQGKKLEVAIALGVDPLIIMAAATPIPVDLSEWLFAG
LYGGSGVALAKCKTVDLEVPADSEFVLEGTITPGEMLPDGPFGDHMGYYGGVEDSPLVRF
QCLTHRKNPVYLTTFSGRPPKEEAMMAIALNRIYTPILRQQVSEITDFFLPMEALSYKAA
IISIDKAYPGQAKRAALAFWSALPQFTYTKFVIVVDKSINIRDPRQVVWAISSKVDPVRD
VFILPETPFDSLDFASEKIGLGGRMGIDATTKIPPETDHEWGEVLESDPAMAEQVSQRWA
EYGLGDINLTEVNPNLFGYDV
Download sequence
Identical sequences L8AD50 P72861
gi|383490264|ref|YP_005407940.1| WP_010871507.1.11876 WP_010871507.1.1889 WP_010871507.1.18904 WP_010871507.1.33690 WP_010871507.1.35395 WP_010871507.1.47586 WP_010871507.1.99424 gi|383324380|ref|YP_005385233.1| gi|383321210|ref|YP_005382063.1| gi|16329469|ref|NP_440197.1| gi|16329469|ref|NP_440197.1| 1148.sll0936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]