SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383490619|ref|YP_005408295.1| from Synechocystis sp. PCC 6803 substr. PCC-N

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383490619|ref|YP_005408295.1|
Domain Number 1 Region: 1-162
Classification Level Classification E-value
Superfamily Globin-like 2.13e-86
Family Phycocyanin-like phycobilisome proteins 0.000000253
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383490619|ref|YP_005408295.1|
Sequence length 162
Comment phycocyanin a subunit [Synechocystis sp. PCC 6803 substr. PCC-N]
Sequence
MKTPLTEAVSTADSQGRFLSSTELQIAFGRLRQANAGLQAAKALTDNAQSLVNGAAQAVY
NKFPYTTQTQGNNFAADQRGKDKCARDIGYYLRIVTYCLVAGGTGPLDEYLIAGIDEINR
TFDLSPSWYVEALKYIKANHGLSGDARDEANSYLDYAINALS
Download sequence
Identical sequences L8AHV8 Q54715
000223329|e4f0tA1|106.1.1.4|A:1-162 cath|current|4f0tA00/1-174 d4f0ta_ 4f0t_A gi|383324735|ref|YP_005385588.1| gi|16329823|ref|NP_440551.1| gi|383490619|ref|YP_005408295.1| gi|383321565|ref|YP_005382418.1| 1148.sll1578 gi|16329823|ref|NP_440551.1| WP_010871860.1.11876 WP_010871860.1.1889 WP_010871860.1.18904 WP_010871860.1.33690 WP_010871860.1.35395 WP_010871860.1.47586 WP_010871860.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]