SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294141470|ref|YP_003557448.1| from Shewanella violacea DSS12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294141470|ref|YP_003557448.1|
Domain Number 1 Region: 640-809
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.46e-49
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 3-193
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.45e-39
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0044
Further Details:      
 
Domain Number 3 Region: 145-309
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0055
Further Details:      
 
Domain Number 4 Region: 526-648
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.62e-20
Family Duplicated SiR/NiR-like domains 1 and 3 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294141470|ref|YP_003557448.1|
Sequence length 867
Comment nitrite reductase [NAD(P)H] large subunit [Shewanella violacea DSS12]
Sequence
MERKPRLLVVGNGMVGHHFIEQLCDQGLNEHFQIVVFGSEQVAAYDRVQLSKYFETGSAA
SLMLANVDIYAKQGVTLHLGKEVTGLDTENKCLHTQDGDFWFYDKLVLATGSYPFVPPIE
GKDRPQCMVYRTIEDLEQIQQAAEKSTSGVVIGGGLLGLEAANALLTLGLETHVVEFASQ
LMPVQLNDKAGDLLRHKIEHLGVSVHTSKATTAIVAGESALHRMNFNDDTYLETDMIVFS
AGIRPQDSLARQSGIEVGERGGIVINDFCLTSADDVYAIGECALWQQRIFGLVAPGYQMA
RAAVSHINAGANKADTSSSLVKFEGADMSTKLKLLGVDVASIGESRGFDKAQFVELTDNQ
AGTYKKLWLDESGRYLKGAVLVGDASDYNLLLNQYLSGDELEGPAVDLLQREEGASIVMK
DNAIICSCHQVTKADLVASVQAGSHSLAEVKACTKAASGCGGCSALVQSVITQTMEEQGL
ETEKGICCHFEYDRQELFHLCQVEEIGDFTTLIKAHGKGEAAAVALGCDICKPVAASIFA
TLDNEYVLKVQHANLQDTNDAYLGNLQKDGSYSVVPRIAGGEITPDKLIALGEIAKRHDL
YTKITGGQRIDLFGAQLSELPMIWQELIEQGFETGHAYGKSLRTVKSCVGSTWCRYGVQD
SISLAIDLENRYKGLRAPHKIKFAVSGCTRECAEAQSKDIGVIASDKGWNLFVGGNGGMR
PRHGDLFATDLSTADLVTYIDRILIFYAKTAARLQRTSVWLESLEGGLDYLKSVVIDDCL
GVAAELETQMEKVVSTYQCEWRTSLENPEFLSRFSEFVNPEKMPQVNVDQYRYSRGQRFP
AGSVGTIAVTNLPSDASPNVELVELSK
Download sequence
Identical sequences D4ZLX1
gi|294141470|ref|YP_003557448.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]