SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404412650|ref|YP_006698237.1| from Listeria monocytogenes SLCC7179

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404412650|ref|YP_006698237.1|
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-65
Family Phosphate binding protein-like 0.00000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404412650|ref|YP_006698237.1|
Sequence length 213
Comment ATP phosphoribosyltransferase [Listeria monocytogenes SLCC7179]
Sequence
MKALKIALTKGRLEKDAVALLEKAGIDCSSMTDKKRKLIFHSSTQPISFILVKAVDVMTY
VKHGVADIGIVGKDVLMEASKSHYEMLDLEIGKCQFCLASTPDFDPSSYRRKIIATKYPT
VASKFFREKGEDVEIIKIEGSVEIAPVLDLADAIIDIVETGSTLKENGLIIYEKMYPISA
RLIVNKASLKQNKTQIFHLIDQLEQAIKEELAE
Download sequence
Identical sequences A0A0H3GEA2 A0A1C7PX50 A0A2G8Q9M7 A0A2G8QL50 A0A2G8QMR0 A0A2G8R2N7 A0A2G8R512 Q8Y9G0
169963.lmo0568 gi|386052831|ref|YP_005970389.1| gi|405757562|ref|YP_006686838.1| gi|404283007|ref|YP_006683904.1| gi|16802611|ref|NP_464096.1| gi|386046226|ref|YP_005964558.1| NP_464096.1.42710 WP_003721362.1.100045 WP_003721362.1.100112 WP_003721362.1.100147 WP_003721362.1.100229 WP_003721362.1.100510 WP_003721362.1.100530 WP_003721362.1.10112 WP_003721362.1.101144 WP_003721362.1.101184 WP_003721362.1.101252 WP_003721362.1.101354 WP_003721362.1.101368 WP_003721362.1.101752 WP_003721362.1.10186 WP_003721362.1.101945 WP_003721362.1.10198 WP_003721362.1.10420 WP_003721362.1.10484 WP_003721362.1.11177 WP_003721362.1.1123 WP_003721362.1.11266 WP_003721362.1.11313 WP_003721362.1.11326 WP_003721362.1.11419 WP_003721362.1.11686 WP_003721362.1.11712 WP_003721362.1.11738 WP_003721362.1.11779 WP_003721362.1.11851 WP_003721362.1.11907 WP_003721362.1.11940 WP_003721362.1.11973 WP_003721362.1.11976 WP_003721362.1.12037 WP_003721362.1.12143 WP_003721362.1.12377 WP_003721362.1.12824 WP_003721362.1.12988 WP_003721362.1.13052 WP_003721362.1.13105 WP_003721362.1.13134 WP_003721362.1.13160 WP_003721362.1.13304 WP_003721362.1.1336 WP_003721362.1.13428 WP_003721362.1.13695 WP_003721362.1.1556 WP_003721362.1.1576 WP_003721362.1.15816 WP_003721362.1.16207 WP_003721362.1.16499 WP_003721362.1.1657 WP_003721362.1.16634 WP_003721362.1.17228 WP_003721362.1.17352 WP_003721362.1.17375 WP_003721362.1.17604 WP_003721362.1.1764 WP_003721362.1.17644 WP_003721362.1.17695 WP_003721362.1.178 WP_003721362.1.1794 WP_003721362.1.17947 WP_003721362.1.1803 WP_003721362.1.18222 WP_003721362.1.18576 WP_003721362.1.18648 WP_003721362.1.18689 WP_003721362.1.18979 WP_003721362.1.19080 WP_003721362.1.19189 WP_003721362.1.19371 WP_003721362.1.19409 WP_003721362.1.20402 WP_003721362.1.20416 WP_003721362.1.21046 WP_003721362.1.21133 WP_003721362.1.21705 WP_003721362.1.21884 WP_003721362.1.21926 WP_003721362.1.21995 WP_003721362.1.22154 WP_003721362.1.22190 WP_003721362.1.22202 WP_003721362.1.22434 WP_003721362.1.22656 WP_003721362.1.22962 WP_003721362.1.23193 WP_003721362.1.23254 WP_003721362.1.23582 WP_003721362.1.23624 WP_003721362.1.2368 WP_003721362.1.2422 WP_003721362.1.24349 WP_003721362.1.24370 WP_003721362.1.24546 WP_003721362.1.24651 WP_003721362.1.24818 WP_003721362.1.24836 WP_003721362.1.24945 WP_003721362.1.24972 WP_003721362.1.25020 WP_003721362.1.25401 WP_003721362.1.26052 WP_003721362.1.26060 WP_003721362.1.26103 WP_003721362.1.26139 WP_003721362.1.26145 WP_003721362.1.26146 WP_003721362.1.26320 WP_003721362.1.26350 WP_003721362.1.26406 WP_003721362.1.26523 WP_003721362.1.26632 WP_003721362.1.26891 WP_003721362.1.27200 WP_003721362.1.27231 WP_003721362.1.27281 WP_003721362.1.27839 WP_003721362.1.28042 WP_003721362.1.28062 WP_003721362.1.28123 WP_003721362.1.28297 WP_003721362.1.28325 WP_003721362.1.28402 WP_003721362.1.28747 WP_003721362.1.28803 WP_003721362.1.2920 WP_003721362.1.29331 WP_003721362.1.29550 WP_003721362.1.29705 WP_003721362.1.29723 WP_003721362.1.29738 WP_003721362.1.29762 WP_003721362.1.29872 WP_003721362.1.29912 WP_003721362.1.30193 WP_003721362.1.30227 WP_003721362.1.30267 WP_003721362.1.305 WP_003721362.1.30827 WP_003721362.1.30882 WP_003721362.1.30902 WP_003721362.1.31108 WP_003721362.1.31116 WP_003721362.1.31444 WP_003721362.1.31485 WP_003721362.1.31584 WP_003721362.1.31830 WP_003721362.1.32209 WP_003721362.1.32210 WP_003721362.1.32278 WP_003721362.1.32402 WP_003721362.1.32622 WP_003721362.1.3324 WP_003721362.1.33336 WP_003721362.1.33688 WP_003721362.1.337 WP_003721362.1.33875 WP_003721362.1.33995 WP_003721362.1.34326 WP_003721362.1.34732 WP_003721362.1.34849 WP_003721362.1.34851 WP_003721362.1.350 WP_003721362.1.35135 WP_003721362.1.35402 WP_003721362.1.35450 WP_003721362.1.36181 WP_003721362.1.36203 WP_003721362.1.36241 WP_003721362.1.364 WP_003721362.1.36599 WP_003721362.1.36877 WP_003721362.1.36936 WP_003721362.1.37278 WP_003721362.1.37518 WP_003721362.1.37561 WP_003721362.1.3782 WP_003721362.1.37882 WP_003721362.1.38025 WP_003721362.1.38076 WP_003721362.1.38150 WP_003721362.1.38224 WP_003721362.1.38471 WP_003721362.1.3853 WP_003721362.1.38733 WP_003721362.1.38792 WP_003721362.1.38800 WP_003721362.1.38833 WP_003721362.1.39115 WP_003721362.1.3919 WP_003721362.1.39262 WP_003721362.1.39351 WP_003721362.1.39554 WP_003721362.1.3959 WP_003721362.1.39630 WP_003721362.1.39887 WP_003721362.1.40124 WP_003721362.1.40263 WP_003721362.1.405 WP_003721362.1.40720 WP_003721362.1.40820 WP_003721362.1.40953 WP_003721362.1.40976 WP_003721362.1.41281 WP_003721362.1.41903 WP_003721362.1.41909 WP_003721362.1.42010 WP_003721362.1.42127 WP_003721362.1.4218 WP_003721362.1.42615 WP_003721362.1.42672 WP_003721362.1.42958 WP_003721362.1.43267 WP_003721362.1.43280 WP_003721362.1.43327 WP_003721362.1.43619 WP_003721362.1.4371 WP_003721362.1.44023 WP_003721362.1.44106 WP_003721362.1.44645 WP_003721362.1.4479 WP_003721362.1.44897 WP_003721362.1.44924 WP_003721362.1.45295 WP_003721362.1.45309 WP_003721362.1.45524 WP_003721362.1.45708 WP_003721362.1.45758 WP_003721362.1.45811 WP_003721362.1.45877 WP_003721362.1.45983 WP_003721362.1.45994 WP_003721362.1.4604 WP_003721362.1.46045 WP_003721362.1.4615 WP_003721362.1.46314 WP_003721362.1.46863 WP_003721362.1.46883 WP_003721362.1.47055 WP_003721362.1.47412 WP_003721362.1.47593 WP_003721362.1.4766 WP_003721362.1.47738 WP_003721362.1.47953 WP_003721362.1.48180 WP_003721362.1.48358 WP_003721362.1.48471 WP_003721362.1.48572 WP_003721362.1.48624 WP_003721362.1.48661 WP_003721362.1.48999 WP_003721362.1.49146 WP_003721362.1.49202 WP_003721362.1.49205 WP_003721362.1.49415 WP_003721362.1.49467 WP_003721362.1.49604 WP_003721362.1.49952 WP_003721362.1.49962 WP_003721362.1.5020 WP_003721362.1.50236 WP_003721362.1.50237 WP_003721362.1.50243 WP_003721362.1.50334 WP_003721362.1.50883 WP_003721362.1.50888 WP_003721362.1.50898 WP_003721362.1.50926 WP_003721362.1.50971 WP_003721362.1.5129 WP_003721362.1.51318 WP_003721362.1.51435 WP_003721362.1.51510 WP_003721362.1.51720 WP_003721362.1.51732 WP_003721362.1.5175 WP_003721362.1.52177 WP_003721362.1.52395 WP_003721362.1.52447 WP_003721362.1.52617 WP_003721362.1.52684 WP_003721362.1.52867 WP_003721362.1.52989 WP_003721362.1.53102 WP_003721362.1.53161 WP_003721362.1.5317 WP_003721362.1.53378 WP_003721362.1.53807 WP_003721362.1.53920 WP_003721362.1.54046 WP_003721362.1.54155 WP_003721362.1.54160 WP_003721362.1.5417 WP_003721362.1.54181 WP_003721362.1.54564 WP_003721362.1.54639 WP_003721362.1.54646 WP_003721362.1.54890 WP_003721362.1.55231 WP_003721362.1.55238 WP_003721362.1.55487 WP_003721362.1.55683 WP_003721362.1.55740 WP_003721362.1.55797 WP_003721362.1.55824 WP_003721362.1.55847 WP_003721362.1.55890 WP_003721362.1.5601 WP_003721362.1.56269 WP_003721362.1.56415 WP_003721362.1.56526 WP_003721362.1.56557 WP_003721362.1.56759 WP_003721362.1.56923 WP_003721362.1.57132 WP_003721362.1.57171 WP_003721362.1.57404 WP_003721362.1.57547 WP_003721362.1.57578 WP_003721362.1.57625 WP_003721362.1.57766 WP_003721362.1.57948 WP_003721362.1.57963 WP_003721362.1.57979 WP_003721362.1.58030 WP_003721362.1.58069 WP_003721362.1.58088 WP_003721362.1.58177 WP_003721362.1.58544 WP_003721362.1.58661 WP_003721362.1.58828 WP_003721362.1.59045 WP_003721362.1.59343 WP_003721362.1.59477 WP_003721362.1.59571 WP_003721362.1.5973 WP_003721362.1.59937 WP_003721362.1.59949 WP_003721362.1.59984 WP_003721362.1.60166 WP_003721362.1.60191 WP_003721362.1.60219 WP_003721362.1.60258 WP_003721362.1.60346 WP_003721362.1.60369 WP_003721362.1.60665 WP_003721362.1.60956 WP_003721362.1.61002 WP_003721362.1.61109 WP_003721362.1.61244 WP_003721362.1.61894 WP_003721362.1.62177 WP_003721362.1.62430 WP_003721362.1.62629 WP_003721362.1.62655 WP_003721362.1.62663 WP_003721362.1.62852 WP_003721362.1.62904 WP_003721362.1.62972 WP_003721362.1.63359 WP_003721362.1.63676 WP_003721362.1.63951 WP_003721362.1.6397 WP_003721362.1.64041 WP_003721362.1.64200 WP_003721362.1.64227 WP_003721362.1.64259 WP_003721362.1.6460 WP_003721362.1.648 WP_003721362.1.65094 WP_003721362.1.65213 WP_003721362.1.65309 WP_003721362.1.65376 WP_003721362.1.65730 WP_003721362.1.6579 WP_003721362.1.65827 WP_003721362.1.65840 WP_003721362.1.65913 WP_003721362.1.66005 WP_003721362.1.66039 WP_003721362.1.66184 WP_003721362.1.66311 WP_003721362.1.66338 WP_003721362.1.66512 WP_003721362.1.6672 WP_003721362.1.66884 WP_003721362.1.66903 WP_003721362.1.67165 WP_003721362.1.67301 WP_003721362.1.6731 WP_003721362.1.67352 WP_003721362.1.67408 WP_003721362.1.67610 WP_003721362.1.6763 WP_003721362.1.67668 WP_003721362.1.67694 WP_003721362.1.67709 WP_003721362.1.67795 WP_003721362.1.67884 WP_003721362.1.68112 WP_003721362.1.68123 WP_003721362.1.68197 WP_003721362.1.68301 WP_003721362.1.68321 WP_003721362.1.68414 WP_003721362.1.68528 WP_003721362.1.69190 WP_003721362.1.69265 WP_003721362.1.69471 WP_003721362.1.69570 WP_003721362.1.69579 WP_003721362.1.69631 WP_003721362.1.69727 WP_003721362.1.70309 WP_003721362.1.7051 WP_003721362.1.70588 WP_003721362.1.70690 WP_003721362.1.70992 WP_003721362.1.71468 WP_003721362.1.71753 WP_003721362.1.71921 WP_003721362.1.72051 WP_003721362.1.72057 WP_003721362.1.72116 WP_003721362.1.7218 WP_003721362.1.72228 WP_003721362.1.72385 WP_003721362.1.72467 WP_003721362.1.72566 WP_003721362.1.72636 WP_003721362.1.72841 WP_003721362.1.734 WP_003721362.1.73769 WP_003721362.1.74217 WP_003721362.1.74290 WP_003721362.1.74351 WP_003721362.1.74450 WP_003721362.1.7454 WP_003721362.1.74572 WP_003721362.1.74754 WP_003721362.1.74837 WP_003721362.1.7498 WP_003721362.1.75069 WP_003721362.1.75240 WP_003721362.1.75541 WP_003721362.1.75604 WP_003721362.1.75624 WP_003721362.1.75670 WP_003721362.1.76124 WP_003721362.1.76769 WP_003721362.1.77116 WP_003721362.1.77149 WP_003721362.1.77192 WP_003721362.1.77246 WP_003721362.1.77350 WP_003721362.1.7736 WP_003721362.1.77376 WP_003721362.1.77420 WP_003721362.1.77681 WP_003721362.1.77823 WP_003721362.1.78121 WP_003721362.1.78167 WP_003721362.1.78203 WP_003721362.1.7832 WP_003721362.1.78336 WP_003721362.1.78525 WP_003721362.1.79184 WP_003721362.1.79212 WP_003721362.1.7932 WP_003721362.1.79351 WP_003721362.1.79434 WP_003721362.1.79458 WP_003721362.1.79630 WP_003721362.1.79803 WP_003721362.1.79964 WP_003721362.1.80028 WP_003721362.1.80036 WP_003721362.1.80105 WP_003721362.1.80790 WP_003721362.1.81261 WP_003721362.1.81503 WP_003721362.1.81662 WP_003721362.1.82274 WP_003721362.1.82440 WP_003721362.1.82667 WP_003721362.1.82719 WP_003721362.1.82893 WP_003721362.1.82951 WP_003721362.1.83030 WP_003721362.1.83121 WP_003721362.1.83137 WP_003721362.1.83215 WP_003721362.1.83260 WP_003721362.1.83323 WP_003721362.1.83350 WP_003721362.1.83478 WP_003721362.1.83546 WP_003721362.1.83932 WP_003721362.1.8418 WP_003721362.1.84265 WP_003721362.1.84320 WP_003721362.1.84367 WP_003721362.1.84539 WP_003721362.1.84579 WP_003721362.1.84586 WP_003721362.1.84588 WP_003721362.1.8460 WP_003721362.1.8473 WP_003721362.1.84781 WP_003721362.1.84833 WP_003721362.1.84980 WP_003721362.1.85037 WP_003721362.1.85203 WP_003721362.1.8593 WP_003721362.1.86091 WP_003721362.1.86253 WP_003721362.1.86308 WP_003721362.1.86484 WP_003721362.1.86597 WP_003721362.1.866 WP_003721362.1.86958 WP_003721362.1.87085 WP_003721362.1.8710 WP_003721362.1.87108 WP_003721362.1.87536 WP_003721362.1.87701 WP_003721362.1.87794 WP_003721362.1.8782 WP_003721362.1.87920 WP_003721362.1.88015 WP_003721362.1.88112 WP_003721362.1.88128 WP_003721362.1.88485 WP_003721362.1.88584 WP_003721362.1.88589 WP_003721362.1.8884 WP_003721362.1.88890 WP_003721362.1.89085 WP_003721362.1.89160 WP_003721362.1.8932 WP_003721362.1.89386 WP_003721362.1.89443 WP_003721362.1.89450 WP_003721362.1.89478 WP_003721362.1.8988 WP_003721362.1.90086 WP_003721362.1.9019 WP_003721362.1.90201 WP_003721362.1.90567 WP_003721362.1.90821 WP_003721362.1.90829 WP_003721362.1.9109 WP_003721362.1.91168 WP_003721362.1.91514 WP_003721362.1.91556 WP_003721362.1.91765 WP_003721362.1.92049 WP_003721362.1.92132 WP_003721362.1.92142 WP_003721362.1.92148 WP_003721362.1.92274 WP_003721362.1.92370 WP_003721362.1.92409 WP_003721362.1.92548 WP_003721362.1.92595 WP_003721362.1.93556 WP_003721362.1.93777 WP_003721362.1.93859 WP_003721362.1.93895 WP_003721362.1.93920 WP_003721362.1.93997 WP_003721362.1.94032 WP_003721362.1.94058 WP_003721362.1.94191 WP_003721362.1.94758 WP_003721362.1.94961 WP_003721362.1.95162 WP_003721362.1.95186 WP_003721362.1.95702 WP_003721362.1.95715 WP_003721362.1.95945 WP_003721362.1.96033 WP_003721362.1.96140 WP_003721362.1.96296 WP_003721362.1.96407 WP_003721362.1.9643 WP_003721362.1.96586 WP_003721362.1.9672 WP_003721362.1.96874 WP_003721362.1.96940 WP_003721362.1.97165 WP_003721362.1.97199 WP_003721362.1.97203 WP_003721362.1.9732 WP_003721362.1.97390 WP_003721362.1.97633 WP_003721362.1.97752 WP_003721362.1.97820 WP_003721362.1.98038 WP_003721362.1.98042 WP_003721362.1.98060 WP_003721362.1.98193 WP_003721362.1.98331 WP_003721362.1.98351 WP_003721362.1.98866 WP_003721362.1.9894 WP_003721362.1.99026 WP_003721362.1.99357 WP_003721362.1.99409 WP_003721362.1.99480 WP_003721362.1.99512 WP_003721362.1.99520 WP_003721362.1.99527 WP_003721362.1.99785 WP_003721362.1.99786 WP_003721362.1.99914 WP_003721362.1.99974 gi|404409800|ref|YP_006695388.1| gi|470209381|ref|YP_007605955.1| gi|284800848|ref|YP_003412713.1| gi|550896737|ref|YP_008666233.1| gi|470206242|ref|YP_007602817.1| gi|386049495|ref|YP_005967486.1| gi|386042895|ref|YP_005961700.1| gi|284994034|ref|YP_003415802.1| gi|404412650|ref|YP_006698237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]