SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404414369|ref|YP_006699956.1| from Listeria monocytogenes SLCC7179

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404414369|ref|YP_006699956.1|
Domain Number 1 Region: 35-264
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.51e-48
Family Phosphate binding protein-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404414369|ref|YP_006699956.1|
Sequence length 269
Comment polar amino acid ABC transporter substrate-binding protein [Listeria monocytogenes SLCC7179]
Sequence
MKKKYGILALALTAALTLSACGGKEEPEAANQKVQTITVGTGTQFPNVCFLDENGKLTGY
DVELVKEIDKRLPGYKFKFKTMDFSNLLVSLGAGKVDIVAHQMEKSKEREKKFLFNDVAY
NNFPLQLTVLDSNNSINSTKDLAGKRVITSATSNGALVLKKINEEQGNNFEIAYEGQGSN
DTANQLKTGRADATISTPFAVDFQNKTSAIKEKVVGDVLSNAKVYFMLGKDETKLSKKVD
EALQSIIDDGTLKKLSEKWLGADYSKEQY
Download sequence
Identical sequences A0A0H3GMT4 A0A1D2IMW6 A0A2G8QGE3 A0A2G8QJ15 A0A2G8QQE2 A0A2G8R7A9 Q8Y4T3
gi|386048013|ref|YP_005966345.1| gi|404284841|ref|YP_006685738.1| gi|386054541|ref|YP_005972099.1| gi|404414369|ref|YP_006699956.1| gi|386044652|ref|YP_005963457.1| gi|470211358|ref|YP_007607932.1| gi|470208218|ref|YP_007604793.1| 169963.lmo2349 gi|550898518|ref|YP_008668014.1| gi|404411592|ref|YP_006697180.1| IDP05245 gi|386051320|ref|YP_005969311.1| gi|405759396|ref|YP_006688672.1| NP_465872.1.42710 WP_003722588.1.100045 WP_003722588.1.100112 WP_003722588.1.100147 WP_003722588.1.100510 WP_003722588.1.100530 WP_003722588.1.101184 WP_003722588.1.101252 WP_003722588.1.101354 WP_003722588.1.101368 WP_003722588.1.101752 WP_003722588.1.10186 WP_003722588.1.101945 WP_003722588.1.11266 WP_003722588.1.11313 WP_003722588.1.11326 WP_003722588.1.11419 WP_003722588.1.11712 WP_003722588.1.11851 WP_003722588.1.11973 WP_003722588.1.11976 WP_003722588.1.12037 WP_003722588.1.12143 WP_003722588.1.12824 WP_003722588.1.13134 WP_003722588.1.13160 WP_003722588.1.13304 WP_003722588.1.1336 WP_003722588.1.13428 WP_003722588.1.13695 WP_003722588.1.137 WP_003722588.1.16207 WP_003722588.1.1657 WP_003722588.1.16634 WP_003722588.1.17228 WP_003722588.1.17375 WP_003722588.1.17604 WP_003722588.1.17644 WP_003722588.1.17695 WP_003722588.1.178 WP_003722588.1.17947 WP_003722588.1.1803 WP_003722588.1.18689 WP_003722588.1.19080 WP_003722588.1.19409 WP_003722588.1.1947 WP_003722588.1.19548 WP_003722588.1.20402 WP_003722588.1.21133 WP_003722588.1.21884 WP_003722588.1.21995 WP_003722588.1.22190 WP_003722588.1.22434 WP_003722588.1.23193 WP_003722588.1.23254 WP_003722588.1.23582 WP_003722588.1.2422 WP_003722588.1.24370 WP_003722588.1.24651 WP_003722588.1.24836 WP_003722588.1.24945 WP_003722588.1.24972 WP_003722588.1.25401 WP_003722588.1.26052 WP_003722588.1.26103 WP_003722588.1.26320 WP_003722588.1.26350 WP_003722588.1.26406 WP_003722588.1.26632 WP_003722588.1.26891 WP_003722588.1.27200 WP_003722588.1.27231 WP_003722588.1.28062 WP_003722588.1.28297 WP_003722588.1.28402 WP_003722588.1.28747 WP_003722588.1.28803 WP_003722588.1.2920 WP_003722588.1.29738 WP_003722588.1.29762 WP_003722588.1.29872 WP_003722588.1.30227 WP_003722588.1.30267 WP_003722588.1.305 WP_003722588.1.31116 WP_003722588.1.31444 WP_003722588.1.31485 WP_003722588.1.31584 WP_003722588.1.31830 WP_003722588.1.32210 WP_003722588.1.32278 WP_003722588.1.32402 WP_003722588.1.32472 WP_003722588.1.32622 WP_003722588.1.3324 WP_003722588.1.33336 WP_003722588.1.33875 WP_003722588.1.33995 WP_003722588.1.34732 WP_003722588.1.34849 WP_003722588.1.34851 WP_003722588.1.350 WP_003722588.1.35450 WP_003722588.1.36203 WP_003722588.1.364 WP_003722588.1.36599 WP_003722588.1.36877 WP_003722588.1.37278 WP_003722588.1.37518 WP_003722588.1.3782 WP_003722588.1.38025 WP_003722588.1.38733 WP_003722588.1.39554 WP_003722588.1.3959 WP_003722588.1.39887 WP_003722588.1.40124 WP_003722588.1.405 WP_003722588.1.40720 WP_003722588.1.40820 WP_003722588.1.40953 WP_003722588.1.41281 WP_003722588.1.42010 WP_003722588.1.42127 WP_003722588.1.42615 WP_003722588.1.42672 WP_003722588.1.43267 WP_003722588.1.43280 WP_003722588.1.43619 WP_003722588.1.4371 WP_003722588.1.44023 WP_003722588.1.44106 WP_003722588.1.44645 WP_003722588.1.4479 WP_003722588.1.44924 WP_003722588.1.45309 WP_003722588.1.45708 WP_003722588.1.45983 WP_003722588.1.4604 WP_003722588.1.46863 WP_003722588.1.47055 WP_003722588.1.4766 WP_003722588.1.48358 WP_003722588.1.48572 WP_003722588.1.48999 WP_003722588.1.49202 WP_003722588.1.49205 WP_003722588.1.49952 WP_003722588.1.49962 WP_003722588.1.50236 WP_003722588.1.50237 WP_003722588.1.50243 WP_003722588.1.50334 WP_003722588.1.50883 WP_003722588.1.50888 WP_003722588.1.50898 WP_003722588.1.5129 WP_003722588.1.51510 WP_003722588.1.51732 WP_003722588.1.52177 WP_003722588.1.52395 WP_003722588.1.52447 WP_003722588.1.52617 WP_003722588.1.52867 WP_003722588.1.53102 WP_003722588.1.53161 WP_003722588.1.53266 WP_003722588.1.54155 WP_003722588.1.54160 WP_003722588.1.5417 WP_003722588.1.54564 WP_003722588.1.55238 WP_003722588.1.55487 WP_003722588.1.55683 WP_003722588.1.55740 WP_003722588.1.55797 WP_003722588.1.56415 WP_003722588.1.56526 WP_003722588.1.56557 WP_003722588.1.56759 WP_003722588.1.57132 WP_003722588.1.57171 WP_003722588.1.57404 WP_003722588.1.57504 WP_003722588.1.57766 WP_003722588.1.57963 WP_003722588.1.57979 WP_003722588.1.58069 WP_003722588.1.58177 WP_003722588.1.58828 WP_003722588.1.59045 WP_003722588.1.59477 WP_003722588.1.5973 WP_003722588.1.59799 WP_003722588.1.59949 WP_003722588.1.59984 WP_003722588.1.60166 WP_003722588.1.60191 WP_003722588.1.60219 WP_003722588.1.60346 WP_003722588.1.60369 WP_003722588.1.60665 WP_003722588.1.61002 WP_003722588.1.61109 WP_003722588.1.61244 WP_003722588.1.62177 WP_003722588.1.62430 WP_003722588.1.62655 WP_003722588.1.62663 WP_003722588.1.62904 WP_003722588.1.63951 WP_003722588.1.64041 WP_003722588.1.64200 WP_003722588.1.64227 WP_003722588.1.6460 WP_003722588.1.648 WP_003722588.1.65094 WP_003722588.1.65730 WP_003722588.1.6579 WP_003722588.1.65827 WP_003722588.1.65840 WP_003722588.1.66005 WP_003722588.1.66039 WP_003722588.1.66184 WP_003722588.1.66311 WP_003722588.1.66338 WP_003722588.1.66512 WP_003722588.1.66884 WP_003722588.1.66903 WP_003722588.1.67165 WP_003722588.1.67301 WP_003722588.1.67408 WP_003722588.1.67709 WP_003722588.1.68112 WP_003722588.1.68321 WP_003722588.1.69265 WP_003722588.1.69471 WP_003722588.1.69579 WP_003722588.1.69631 WP_003722588.1.69727 WP_003722588.1.70690 WP_003722588.1.70992 WP_003722588.1.71468 WP_003722588.1.71753 WP_003722588.1.72051 WP_003722588.1.72116 WP_003722588.1.72467 WP_003722588.1.72566 WP_003722588.1.72636 WP_003722588.1.72841 WP_003722588.1.734 WP_003722588.1.73656 WP_003722588.1.73769 WP_003722588.1.74217 WP_003722588.1.74450 WP_003722588.1.7454 WP_003722588.1.74572 WP_003722588.1.74754 WP_003722588.1.7498 WP_003722588.1.75541 WP_003722588.1.75624 WP_003722588.1.75670 WP_003722588.1.77192 WP_003722588.1.77350 WP_003722588.1.77376 WP_003722588.1.77420 WP_003722588.1.77681 WP_003722588.1.77823 WP_003722588.1.78167 WP_003722588.1.7832 WP_003722588.1.78336 WP_003722588.1.79184 WP_003722588.1.79212 WP_003722588.1.79351 WP_003722588.1.79434 WP_003722588.1.79458 WP_003722588.1.79630 WP_003722588.1.79964 WP_003722588.1.80028 WP_003722588.1.80036 WP_003722588.1.80105 WP_003722588.1.81261 WP_003722588.1.81662 WP_003722588.1.81713 WP_003722588.1.82440 WP_003722588.1.82893 WP_003722588.1.82951 WP_003722588.1.83121 WP_003722588.1.83137 WP_003722588.1.83215 WP_003722588.1.83260 WP_003722588.1.83350 WP_003722588.1.83542 WP_003722588.1.83546 WP_003722588.1.8418 WP_003722588.1.84539 WP_003722588.1.84579 WP_003722588.1.84588 WP_003722588.1.84980 WP_003722588.1.85037 WP_003722588.1.85203 WP_003722588.1.8593 WP_003722588.1.86253 WP_003722588.1.86308 WP_003722588.1.86484 WP_003722588.1.86597 WP_003722588.1.866 WP_003722588.1.86958 WP_003722588.1.8710 WP_003722588.1.87536 WP_003722588.1.87701 WP_003722588.1.87794 WP_003722588.1.87920 WP_003722588.1.88485 WP_003722588.1.8884 WP_003722588.1.88890 WP_003722588.1.8932 WP_003722588.1.89386 WP_003722588.1.89443 WP_003722588.1.89478 WP_003722588.1.89809 WP_003722588.1.8988 WP_003722588.1.90201 WP_003722588.1.90567 WP_003722588.1.90829 WP_003722588.1.91556 WP_003722588.1.91765 WP_003722588.1.92132 WP_003722588.1.92148 WP_003722588.1.92409 WP_003722588.1.92548 WP_003722588.1.92595 WP_003722588.1.93920 WP_003722588.1.94032 WP_003722588.1.94058 WP_003722588.1.94758 WP_003722588.1.94961 WP_003722588.1.95945 WP_003722588.1.96140 WP_003722588.1.96296 WP_003722588.1.96407 WP_003722588.1.96874 WP_003722588.1.96940 WP_003722588.1.97203 WP_003722588.1.9732 WP_003722588.1.97390 WP_003722588.1.97633 WP_003722588.1.97820 WP_003722588.1.98042 WP_003722588.1.98193 WP_003722588.1.98331 WP_003722588.1.98866 WP_003722588.1.9894 WP_003722588.1.99026 WP_003722588.1.9916 WP_003722588.1.99409 WP_003722588.1.99480 WP_003722588.1.99512 WP_003722588.1.99520 WP_003722588.1.99527 WP_003722588.1.99785 WP_003722588.1.99786 WP_003722588.1.99914 gi|16804387|ref|NP_465872.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]