SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404414434|ref|YP_006700021.1| from Listeria monocytogenes SLCC7179

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404414434|ref|YP_006700021.1|
Domain Number 1 Region: 35-274
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.64e-73
Family Phosphate binding protein-like 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|404414434|ref|YP_006700021.1|
Sequence length 276
Comment D-methionine ABC transporter substrate-binding protein [Listeria monocytogenes SLCC7179]
Sequence
MKKVLGLIFTLSLVLVLTACGGSSDKASSSKDDKQLVVGASNTPHAQILEQAKPILKDKG
IDLKIVKYTDYVMPNKALEEGDLDANYFQHKPYLELEEKEKGYKFADVGAIHIEPMGIYS
KKVKDIKDLKDGAQVLLSNSKSDWPRVIGIFVDNGLLTLKDGVKPQDATFDDIKDNPKNL
KFKYDFDPAYLMTAYNNEEGDVVAINSNFVVDQGLNPSKDAIAIESKDSPYANIVVTTEK
KKDDKNIKELVKVLHSKEIQDYITKEWDGAVVPVDK
Download sequence
Identical sequences WP_003722445.1.100045 WP_003722445.1.100229 WP_003722445.1.100510 WP_003722445.1.101354 WP_003722445.1.10186 WP_003722445.1.11326 WP_003722445.1.11419 WP_003722445.1.11686 WP_003722445.1.11738 WP_003722445.1.12824 WP_003722445.1.12988 WP_003722445.1.13160 WP_003722445.1.16634 WP_003722445.1.17228 WP_003722445.1.17604 WP_003722445.1.178 WP_003722445.1.1803 WP_003722445.1.18576 WP_003722445.1.18648 WP_003722445.1.18689 WP_003722445.1.21705 WP_003722445.1.21884 WP_003722445.1.22434 WP_003722445.1.24651 WP_003722445.1.24836 WP_003722445.1.24945 WP_003722445.1.25020 WP_003722445.1.26103 WP_003722445.1.26139 WP_003722445.1.26320 WP_003722445.1.27281 WP_003722445.1.28042 WP_003722445.1.28803 WP_003722445.1.29550 WP_003722445.1.29872 WP_003722445.1.29912 WP_003722445.1.30193 WP_003722445.1.30267 WP_003722445.1.31116 WP_003722445.1.31485 WP_003722445.1.31584 WP_003722445.1.32278 WP_003722445.1.33336 WP_003722445.1.33995 WP_003722445.1.34849 WP_003722445.1.34851 WP_003722445.1.36181 WP_003722445.1.37278 WP_003722445.1.37518 WP_003722445.1.3782 WP_003722445.1.38025 WP_003722445.1.38224 WP_003722445.1.38833 WP_003722445.1.39115 WP_003722445.1.3919 WP_003722445.1.39630 WP_003722445.1.405 WP_003722445.1.41903 WP_003722445.1.42010 WP_003722445.1.4218 WP_003722445.1.42615 WP_003722445.1.42672 WP_003722445.1.4371 WP_003722445.1.45811 WP_003722445.1.45994 WP_003722445.1.47593 WP_003722445.1.48180 WP_003722445.1.48661 WP_003722445.1.49146 WP_003722445.1.49205 WP_003722445.1.49668 WP_003722445.1.51318 WP_003722445.1.52617 WP_003722445.1.52989 WP_003722445.1.5317 WP_003722445.1.53378 WP_003722445.1.5417 WP_003722445.1.54639 WP_003722445.1.55824 WP_003722445.1.55890 WP_003722445.1.5601 WP_003722445.1.56759 WP_003722445.1.57505 WP_003722445.1.57547 WP_003722445.1.57578 WP_003722445.1.57625 WP_003722445.1.57948 WP_003722445.1.58069 WP_003722445.1.58088 WP_003722445.1.60191 WP_003722445.1.60219 WP_003722445.1.62972 WP_003722445.1.63359 WP_003722445.1.63951 WP_003722445.1.64259 WP_003722445.1.65376 WP_003722445.1.65827 WP_003722445.1.6672 WP_003722445.1.66903 WP_003722445.1.67165 WP_003722445.1.6731 WP_003722445.1.67668 WP_003722445.1.67694 WP_003722445.1.68112 WP_003722445.1.68123 WP_003722445.1.68321 WP_003722445.1.69570 WP_003722445.1.69631 WP_003722445.1.7051 WP_003722445.1.70690 WP_003722445.1.71753 WP_003722445.1.72116 WP_003722445.1.72385 WP_003722445.1.72566 WP_003722445.1.73769 WP_003722445.1.7454 WP_003722445.1.75240 WP_003722445.1.75624 WP_003722445.1.75670 WP_003722445.1.77376 WP_003722445.1.78167 WP_003722445.1.78336 WP_003722445.1.79212 WP_003722445.1.7932 WP_003722445.1.79351 WP_003722445.1.79434 WP_003722445.1.79458 WP_003722445.1.80105 WP_003722445.1.82667 WP_003722445.1.83121 WP_003722445.1.83137 WP_003722445.1.83350 WP_003722445.1.84320 WP_003722445.1.84367 WP_003722445.1.84579 WP_003722445.1.8473 WP_003722445.1.84980 WP_003722445.1.86308 WP_003722445.1.87794 WP_003722445.1.8782 WP_003722445.1.88112 WP_003722445.1.88589 WP_003722445.1.8884 WP_003722445.1.89443 WP_003722445.1.8988 WP_003722445.1.90086 WP_003722445.1.91168 WP_003722445.1.91514 WP_003722445.1.91765 WP_003722445.1.92049 WP_003722445.1.93556 WP_003722445.1.93920 WP_003722445.1.93997 WP_003722445.1.94032 WP_003722445.1.95162 WP_003722445.1.95715 WP_003722445.1.95945 WP_003722445.1.96940 WP_003722445.1.97203 WP_003722445.1.98060 WP_003722445.1.98351 WP_003722445.1.98866 WP_003722445.1.99026 WP_003722445.1.99480 WP_003722445.1.99785 WP_003722445.1.99974 gi|386048083|ref|YP_005966415.1| gi|404414434|ref|YP_006700021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]