SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|404414521|ref|YP_006700108.1| from Listeria monocytogenes SLCC7179

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|404414521|ref|YP_006700108.1|
Domain Number 1 Region: 249-436
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 2.77e-51
Family Peptidoglycan hydrolase LytM 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|404414521|ref|YP_006700108.1|
Domain Number - Region: 30-119
Classification Level Classification E-value
Superfamily Tropomyosin 0.00085
Family Tropomyosin 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|404414521|ref|YP_006700108.1|
Sequence length 436
Comment peptidase M23/M37 family protein [Listeria monocytogenes SLCC7179]
Sequence
MLKKYGVATALSLLIISAPLTGAHADTINDMQKRQNEIEQKKSEIDKNIDSKNSELNHLE
SAEKDAAKELESLMKSLDDTNKKLKEQEDKVSSENEKLKKLQKEMEKLRNDIRDRQKVLD
NRARAIQTTGTATSYLDMIFEADDFKELVDRVTVVSAIVKADQNIMQDQKDDQDKLKVAE
STSEKKLENLKVLAVELEVSKNNMESQKQEKNDLVMALANKKDLTKSEQTLLASEQGALT
DEEKRLASNIAGEKAKQEAAIKAAQEKRMQEAAAASSAKSAAVVKQPSSSSNEATETVSS
GGGQFIKPASGILTSGFSERTNPVTGKYESHKGQDIAGGGTVTVSAAASGTVVFSGFGAS
GSGFGGYGYVVKIDHGNGFQTLYGHMRAGSLKVVTGQQVSQGQPIGIMGSTGQSTGQHLH
FEIHKNGIPVDPAPYI
Download sequence
Identical sequences WP_014931668.1.10186 WP_014931668.1.31116 WP_014931668.1.42010 WP_014931668.1.60191 WP_014931668.1.66903 WP_014931668.1.73769 WP_014931668.1.83350 WP_014931668.1.98866 gi|404414521|ref|YP_006700108.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]