SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269954951|ref|YP_003324740.1| from Xylanimonas cellulosilytica DSM 15894

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269954951|ref|YP_003324740.1|
Domain Number 1 Region: 423-500
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000432
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269954951|ref|YP_003324740.1|
Sequence length 507
Comment sulfate transporter [Xylanimonas cellulosilytica DSM 15894]
Sequence
MPTPHTVSVRAVLRSPRLLRIEILAGLVTAFALIPEATAFSIVLGVDPRLGLFSSFVGAV
AIALLGGRPAMVSAAAGSVALVAVPLVREHGADYLIVAVVLSGLLQVVLGVAGVARLMRF
IPRSVMVGFVNGLAILIFWSQVRHLVGVPWAVYPLVAAGIAVVVLFPRVTKAVPAPLVAI
VALTVVAVAGGLDVPTVGDEGALPQSLPSLLIPDVPLTLDTLRIVAPYVAGMALVGLLES
LLTAKLVDDVTDTRSDKSREAWGLGVTNVLAGLFGGQGVCAMIGQTVINVRGAGARSRVS
TFMAGVFVLVLVVGLNDVVAQIPMAALVAVMIMVAVMTFDWHSVRPATLRRMPRSETTVM
VATVVVTVATDNLAVGVLVGVVVAMVMFARRVAHFTSVTPMDDVAAVGPGLTSDADDGAP
RRRTYVVEGELFFASSNDLVYQFDYADDPDDVVVDLTRAHVWDASTVATLDAIQTKYAAR
GKRVTIVGANPDTAARLTRLSTLTPGG
Download sequence
Identical sequences D1BU18
446471.Xcel_0142 gi|269954951|ref|YP_003324740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]