SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269956873|ref|YP_003326662.1| from Xylanimonas cellulosilytica DSM 15894

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269956873|ref|YP_003326662.1|
Domain Number 1 Region: 428-535
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000451
Family Anti-sigma factor antagonist SpoIIaa 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269956873|ref|YP_003326662.1|
Sequence length 554
Comment sulfate transporter [Xylanimonas cellulosilytica DSM 15894]
Sequence
MSLRELMPSRADYDLRPRTLGADLVAGVTVGVVALPLALAFGVSSGVGAAAGLVTAVVAG
IVAAVFGGSGVQVSGPTGAMAVVLAPIVAQHGIGSVALVSVIAGAVVLAAGALRLGRIIT
YIPWPVVEGFTLGIACIIFLQQVPAAVGVAAAPGGNTAVAAVQAVAAATPSAAAWTLGAV
AVVAATMLVLGRFAKAVPASLVAVAAVTLLAELFDAPVARIGALPDTLPLPVLPTASAGA
LRDIAGAALAVAALAAIESLLSARVAAGMTTTGSVYHPDRELVGQGLASVASGLFGGMPA
TGAIARTAVNVRSGARTRLAAVVHALVILGVIYLATGPVSRIPLAALAGVLMVTATRMVP
TRTVLQVVRASRSTAVTFAVTAVITVAFDLIEAVQIGVLVAAFFALRAVARAATVHREPL
PGPARPGDEHVALFRLEGAMFFGAADRVLTEVSHDSLRDGIRVVVLRLSGLRMVDATGAK
ALADLLAALERGGVTVLVKGVQPGHLGMLRNVGVLDELADERHLFDTLEDAVAHARALVA
SDPGNPAPPLVPAG
Download sequence
Identical sequences D1BU91
446471.Xcel_2086 gi|269956873|ref|YP_003326662.1| WP_012878846.1.53538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]