SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269957233|ref|YP_003327022.1| from Xylanimonas cellulosilytica DSM 15894

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269957233|ref|YP_003327022.1|
Domain Number 1 Region: 6-294
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 3.53e-70
Family ATP synthase (F1-ATPase), gamma subunit 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269957233|ref|YP_003327022.1|
Sequence length 298
Comment ATP synthase F1 subunit gamma [Xylanimonas cellulosilytica DSM 15894]
Sequence
MAGGSQRVYRQRIKSTQSLKKMFRAQELIAASRIGRARNRATSTTPFAQAITRAVSAVAT
HAHVEHPMTQARHDTNRVAVLVVASDRGMAGSYSAAIIRETERLLERLEREGKQPELFVT
GRRAISYYRYRGRELRGQWSYGSDSPSAEVAHEIADALLAAHSAPAEDGGVAELHVVYTQ
FVNMVTQRPRVVRMLPLEVVEGVVEHEDVEPLYDFEPSVEVVLDALLPRYVRSRLFSFLL
EAAASELASRQRAMHTAVDNAEDLIRNYTRLANQARQADITQEISEIVSGADALAAAK
Download sequence
Identical sequences D1BWB9
WP_012879206.1.53538 gi|269957233|ref|YP_003327022.1| 446471.Xcel_2449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]