SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269957909|ref|YP_003327698.1| from Xylanimonas cellulosilytica DSM 15894

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269957909|ref|YP_003327698.1|
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 9.42e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269957909|ref|YP_003327698.1|
Sequence length 140
Comment anti-sigma-factor antagonist [Xylanimonas cellulosilytica DSM 15894]
Sequence
MIEIATSPTTTTLVITGDLDLAERDQFPEIASRVVGLRRQLLVIDMCRVTFMDSTGAAFL
ISLADSGRKRGGATVLRGADERDLFVLEVCGALEMFRVDHDHGCEGTAASTAFTRPAAEA
EPPAPSSSGPLPQRPRPSAG
Download sequence
Identical sequences D1C012
gi|269957909|ref|YP_003327698.1| 446471.Xcel_3139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]