SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101076|ref|YP_003552934.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101076|ref|YP_003552934.1|
Domain Number 1 Region: 4-89
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.14e-23
Family ArsR-like transcriptional regulators 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101076|ref|YP_003552934.1|
Sequence length 126
Comment ArsR family transcriptional regulator [Aminobacterium colombiense DSM 12261]
Sequence
MDASLQQEKAAIFKALGHPVRLSIVETLEKGEMCACEIAELFHFDRTTISKHLAILRDLH
IIEDRKDGLHIYYSLKMRCLASMLQCVERVIQGHPVYEEHHLQCFCAARKEREDENTDIG
NRLPKM
Download sequence
Identical sequences D5ECC8
WP_013047476.1.58668 gi|294101076|ref|YP_003552934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]