SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|294101099|ref|YP_003552957.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101099|ref|YP_003552957.1|
Domain Number 1 Region: 75-257
Classification Level Classification E-value
Superfamily GAF domain-like 4.38e-52
Family IclR ligand-binding domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 11-82
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000137
Family Transcriptional regulator IclR, N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294101099|ref|YP_003552957.1|
Sequence length 259
Comment IclR family transcriptional regulator [Aminobacterium colombiense DSM 12261]
Sequence
MAGARKNPGYVQSIERAMSIIEVLDEHGELGISEISDELGLEPSTVHRIVSTLKGLGYVN
QNRENHKYSNSFKLFEIGNNVVKALGLKKQAMPFMRELSDKTNEAVNLAVMDGKYVIYID
KIESQSTIRVDLSVGKRMPTYCTGLGKIMLAYMPETKVRELLEDEPFARFTKNTVPDLET
LFQHLARIRKQGYCIDNEEYIEGLFCVAAPVWGHSGEVLAALSVAVPKFLYADTERLFAI
RDLVIDVAKRFSTTLGYKS
Download sequence
Identical sequences D5ECF1
gi|294101099|ref|YP_003552957.1| WP_013047499.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]