SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101132|ref|YP_003552990.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|294101132|ref|YP_003552990.1|
Domain Number - Region: 284-390
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0222
Family 2-methylcitrate dehydratase PrpD 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101132|ref|YP_003552990.1|
Sequence length 444
Comment hypothetical protein [Aminobacterium colombiense DSM 12261]
Sequence
MFTVKEFLRSEVKPALGCTEPGAVALAVARAWKEADCECVRDVEVTVSSSIYKNGIAVGI
PGTNGLKGNVVAAALAAVCGNPEYGLEVLRDCSEEAVQKAQDLVGEGKVKIIADMNRHGV
YVKAVVTTAHHLSECVIEGSHTNIIKVTLDGKSRYTLQGISQNTQKNEEKSISDQIKAMT
YSETVRLIEDLDEEDVDYVMEGVRMNMEIARLGLDTTRKLGLGVGKTMMKFAGDGTDLRT
LGDKVKAISAAAADARMSGASLPVMSSAGSGNHGITAILPVSIVAEHYQKSREETARAIA
LSHLTTSFIKSRMGRLSPVCGCSVAAGAGAAAGMTFLLSGDLHKAEKAVEILVSNLVGML
CDGAKDTCALKVGTGAYEAYCAAMIVLEGNELDGPQGVVGETIEKTIENASAINIEGMID
VDRIIIEFVSKRYADEEALKNAVS
Download sequence
Identical sequences D5ECI4
WP_013047532.1.58668 gi|294101132|ref|YP_003552990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]