SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101290|ref|YP_003553148.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101290|ref|YP_003553148.1|
Domain Number 1 Region: 10-273
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.69e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000618
Further Details:      
 
Domain Number 2 Region: 276-402
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.05e-24
Family Anticodon-binding domain of Class II aaRS 0.00032
Further Details:      
 
Domain Number 3 Region: 408-479
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 0.00000000000000192
Family C-terminal domain of ProRS 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101290|ref|YP_003553148.1|
Sequence length 479
Comment prolyl-tRNA synthetase [Aminobacterium colombiense DSM 12261]
Sequence
MARNITPKETDYSQWYLDIIKVAELADYAPVRGCMVIRPTGYSLWESIQKHFDDAFKETG
HVNAYFPVLIPNSFLEKEAEHVEGFSPECAVVTHAGGELLEEPLVVRPTSETVIGHMYSK
WIQSWRDLPILINQWANVMRWEKRPRLFLRTSEFLWQEGHTAHATEEEAMEETLKMLEVY
RRIMTEILAIPVIVGEKTAGERFPGAVNTYTCEAMMSDKKALQAGTSHFLGQNFSRAFDI
QFQNQKGEQEYAWTTSWGVSTRLIGALIMTHSDNDGLILPPRVAPVQVAILPISTNDSVM
EEQLLPRALEFSDKLDQMLGGRFTFVDKQFHMRPGDRFFYHLQKGVPLRLELGEKDLAAG
TVRAVRRDTGSKEDIPFENVPLRVKALLEDIHKNLYTRALDFRIANTFSASTLEELKVIV
EEKGGFVETYFAGTPEEEKKIREETGATPRCMPLNDTCTGTCFLTGKPHARKTIFAKAY
Download sequence
Identical sequences D5ECZ2
gi|294101290|ref|YP_003553148.1| WP_013047690.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]