SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101358|ref|YP_003553216.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101358|ref|YP_003553216.1|
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.41e-26
Family Cold shock DNA-binding domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|294101358|ref|YP_003553216.1|
Sequence length 66
Comment cold-shock DNA-binding domain-containing protein [Aminobacterium colombiense DSM 12261]
Sequence
MAQGTVKWFNDSKGYGFITTDEGKDVFVHYSAIMGDGFKTLAENQRVSFDVTQGEKGPQA
ANVQKL
Download sequence
Identical sequences D5ED60
WP_013047758.1.58668 gi|294101358|ref|YP_003553216.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]