SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101376|ref|YP_003553234.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101376|ref|YP_003553234.1|
Domain Number 1 Region: 173-437
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.31e-69
Family Extended AAA-ATPase domain 0.000000126
Further Details:      
 
Domain Number 2 Region: 446-697
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.31e-67
Family Extended AAA-ATPase domain 0.00000132
Further Details:      
 
Domain Number 3 Region: 2-84
Classification Level Classification E-value
Superfamily ADC-like 2.94e-22
Family Cdc48 N-terminal domain-like 0.0049
Further Details:      
 
Domain Number 4 Region: 88-178
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.0000000000392
Family Cdc48 domain 2-like 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101376|ref|YP_003553234.1|
Sequence length 706
Comment AAA ATPase [Aminobacterium colombiense DSM 12261]
Sequence
MPLRVKEALSKDVGRCIARIDPEDIKRYGLSEGQIIELEGKRKTPARLLACDSGDMGQKA
IQIDGITRENAQVGLDEKISIHKVDHHFAGSITLRPLTSTPLLEKERDSVYLSNLLEGLP
VIEGDRIRANLYGTRTCDFLVTDTTPKGIVLISNATYINVEKQLSQEQKTSRISYEDIGG
LGPQIQRVREMIELPLRFPQVFDRLGVQPPKGVLLYGPPGTGKTVIARAVANETDVYFTH
ISGPEIIGKFYGESEERLRNVFDEAQAHAPAIIFIDEIDAIAPKREEMGGEKQVERRVVA
QLLALMDGLESRGQVIVIGATNIPNTLDPALRRPGRFDREISIPIPDRNGRFEILQIHTR
GMPLAEDVDLMRLSDITHGFVGADLEALAKEAAMSSLRELLPCIDYEQAVIPYEKLLSMN
VTMENFLDALKEVEPSAIREVFVEVPDVTWSDIGGLEAIKEELIEAVQWPLKYNSVYEKF
NITPPQGILLHGPSGTGKTLLVRALAHESGVNFIPVKGPALMSKYVGESERAIREVFKKA
KQASPSILYFDEIESLVPIRGRDSGAGASFTERVISQFLAEMSGIEELKGVTVLATTNRI
DLIDPALLSSGRFDVVLELPMPDAKARLEIFQIHLQKKPLAEDVHLEELVRSTEGHSGGD
IHFICRKASALAIRDFLKIGEKGAPCIEKHHFEIALSLLKSNRSLQ
Download sequence
Identical sequences D5ED78
WP_013047776.1.58668 gi|294101376|ref|YP_003553234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]