SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101416|ref|YP_003553274.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101416|ref|YP_003553274.1|
Domain Number 1 Region: 2-132
Classification Level Classification E-value
Superfamily CheY-like 2.13e-33
Family CheY-related 0.00057
Further Details:      
 
Domain Number 2 Region: 139-204
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.45e-21
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|294101416|ref|YP_003553274.1|
Sequence length 211
Comment two component LuxR family transcriptional regulator [Aminobacterium colombiense DSM 12261]
Sequence
MTIRVVLADDHPLTRAGLSAYLQQENSIELVGEAEDGEKAWELIVDLKPDVALLDIRMPG
EDGVSIARRIKEEKLPVIPVMLTSYDAHQYVVASLRAGARGFILKTSTPQDLIRAIQTVV
QGGLYLDSEVATVVGDRELVPESLSAREREVLVLASKGLSSKEVAAELFISERTVQTHLA
SIYDKLGARNKTEALLLALKYGVVTLEELLE
Download sequence
Identical sequences D5EDB8
WP_013047816.1.58668 gi|294101416|ref|YP_003553274.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]