SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|294101537|ref|YP_003553395.1| from Aminobacterium colombiense DSM 12261

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|294101537|ref|YP_003553395.1|
Domain Number 1 Region: 6-314
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 2.75e-101
Family Tex N-terminal region-like 0.0000014
Further Details:      
 
Domain Number 2 Region: 315-460
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.29e-42
Family Tex RuvX-like domain-like 0.0000185
Further Details:      
 
Domain Number 3 Region: 461-549
Classification Level Classification E-value
Superfamily RuvA domain 2-like 6.23e-29
Family Tex HhH-containing domain-like 0.00037
Further Details:      
 
Domain Number 4 Region: 628-717
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.13e-24
Family Cold shock DNA-binding domain-like 0.0000948
Further Details:      
 
Domain Number 5 Region: 552-621
Classification Level Classification E-value
Superfamily RuvA domain 2-like 9.34e-19
Family Tex HhH-containing domain-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|294101537|ref|YP_003553395.1|
Sequence length 718
Comment Tex-like protein [Aminobacterium colombiense DSM 12261]
Sequence
MVQQKLNLVLAISTEMKISSAQIEAVFSLLDEGCTIPFIARYRKEATGSLDEVSIARIRD
RREELLELEKRRLAILKSLEDREILTDELAQAINGAANLTTLEDTYLPYRPKRKTRASMA
LEKGLALLAENIMAQDGCNPRHEAKAFIDVEKGVESIEEALKGALDIIAERVSENSEARN
VCRRIFARHSYITSALVSEKENEAAKYKDYFSWKERAIEAPSHRILALFRGENEGMLSLK
IQPDEMLCLSALKKLFIKTKGEEADLFEEAITDGYKRLLSPSMETELRNALKKRADEEAI
SVFAQNIREILMTPPLGYKNILAVDPGFRTGCKVVCLNRQGSLIFTDTIYPHPPINRQEE
SAKKIRETVNKFSIEAIAIGNGTAGRETETFIKTLNLPQNIITTMVNESGASVYSASEIA
RKEFPDHDVTVRGAVSIGRRLMDPLAELIKIDPRSLGVGQYQHDVDQKALKRALDDAVMS
CVNAVGVDINTASRELLTFVSGVGPQLAANIVKYREENGLFNTRNDLKKVPRLGPKSFQQ
CAGFLRIQGGVNPLDSSAVHPENYALVKNMASDLNTTVKELMGKAEIRQRIDITRYVKGE
IGLPTLKDIMEELEKPGRDPRCIFEEFSFVDGITDISHLKKGMVLPGIITNVTAFGAFVD
IGVHQDGLVHISALSDKYISSPHAVVSPGQQVKVIVMDIDMDRKRISLSMKTSDLEEK
Download sequence
Identical sequences D5EDN9
gi|294101537|ref|YP_003553395.1| WP_013047937.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]